Conserved Protein Domain Family
SURF6

?
pfam04935: SURF6 
Surfeit locus protein 6
The surfeit locus protein SURF-6 is shown to be a component of the nucleolar matrix and has a strong binding capacity for nucleic acids.
Statistics
?
PSSM-Id: 398547
Aligned: 128 rows
Threshold Bit Score: 57.6363
Threshold Setting Gi: 761907664
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WGS:AAWC:PGTG_01427.3 168 EALLDLERKKRGEMRDRRRKERKEARSkekqnkleqsllkkkklsgsasskpsnapsgSGNRQKGDKTAQ--DDQPKKdv 245 Puccin...
P70279                137 AATLEKRQRRKQERERKKRKRKERQAK-------------------------------QQVAEAEK------KEEPVE-- 177 house ...
XP_002820387          139 PAALEKRRRRKQERDRKKRKRKELRAK-------------------------------EKARKAEEAAEA--QEVVEP-- 183 Sumatr...
XP_002195958          144 PAVLEKRQRRKYERERKKRRRKELKMK-------------------------------AKMEKKETEEAP--AEPENK-- 188 zebra ...
XP_005990683          127 EELEKKRLKRKQERERKKRKRKEIRIK-------------------------------KEQEKKTATETS--QTSESQ-- 171 coelac...
Q68F76                125 EEVEKRRQRRKQERERKKRKRKELKKK-------------------------------AAQEPEEV------EVKDAE-- 165 tropic...
XP_015222462          143 EDLAKKRARRKQERERKKRKRKEIRMK-------------------------------KLAEKTGEGETA--EESKGD-- 187 spotte...
XP_007257025          145 EEVQKRRAKRKQERERKKRKRKEFRMK-------------------------------ALAQSSTTEIKE--ESEPVE-- 189 Mexica...
Q6DRK9                135 DEVKMKREKRKQERERRKRKRKEFRLK-------------------------------KLADAAGLQPVDvkEIKTEPee 183 zebrafish
XP_004074591          137 EAVQAKRAKRKLERERKKRKKKEFQMK-------------------------------KLAEKSDKVPPV--EVKKEE-- 181 Japane...
WGS:AAWC:PGTG_01427.3 246 sknAAPPSKSSHPNPSpskaekpsagpapaegskssTknqapaqepDLAFSSLSFdlkqstgVEGGHSHGQKNP------ 319 Puccin...
P70279                178 ---VTPKMACKELQES------------------------------GLIFNKVEVte---eePASKAQRKKEKRqkvk-g 220 house ...
XP_002820387          184 ---TPEGACTEPREPP------------------------------GLIFNKVEVse---dePASKAQRRKEKRqrvk-g 226 Sumatr...
XP_002195958          189 ---------KEESKA-------------------------------EIVFNRVEVhee--ndLNKVQKKKEKRKavkg-- 224 zebra ...
XP_005990683          172 ---ERKESSKEEE---------------------------------MVVFNKVEVh-----dEVLNKPLKKKLKnqsikg 210 coelac...
Q68F76                166 ---EGQETNKKEKDQV------------------------------PIVFNNMEVsd---elPNKVMQKKAKKErvkg-- 207 tropic...
XP_015222462          188 ---GAKVENPGGTGGRgg----------------aeT---------SIVFNKVDLsg---eyVSKAQQKKEKRKkikg-- 234 spotte...
XP_007257025          190 ---ITTPQSEPAESKSdkk------------------------dtsTLVFNKVEVed---dyVDKGTKMREKKKkrkvkg 239 Mexica...
Q6DRK9                184 dstATSSVPAKKEQS-------------------------------FIVFNKMEVge---dyVDKGTKMMEKKKrkvk-g 228 zebrafish
XP_004074591          182 ---EQAPAPKKRDEA-------------------------------AIVFNTVQIve----eAYVDKMLKKKEKkqkvkg 223 Japane...
WGS:AAWC:PGTG_01427.3 320 ---SWTSKKPQEAKTALDRREAYLEKLTP---EARERAEESKKWEKANLQASGTKVMDDRKKIEKALKKQTKEKKKKKHQ 393 Puccin...
P70279                221 nltPLTGRNYRQLLDRLQARQGRLDELRDqdaAKAQELEAKMKWTNLLYKAEGVKIRDDERLLQEALKRKEKRRAQRQRK 300 house ...
XP_002820387          227 nltPLTGRNYRQLLERLQARQSRLDELRGqdeGKAQELEAKMKWTNLLYKAEGVKIRDDEHLLQEALKRKEKRRAQRQRR 306 Sumatr...
XP_002195958          225 nitPLTGKNYKQLLSRLEIRKNKLEELKEkdeKKAQELETKIKWTNALYKAEGVKIRDDEERLKEALKRKEKRKAQRKRQ 304 zebra ...
XP_005990683          211 nitPLTGKNYKQLLSRLEARKNKIEELKSkdeKKAKELEAKMQWTNVLYKAEGIKIKDNEEMLKTALKQKEKRKAQRQKR 290 coelac...
Q68F76                208 nitPMTGKNYKQLLGRLEARKTKLEELREkdeGKAKEFESKIKWTNVLYKAEGVKIKDDEGMLKAALKRKEKMKKQREKR 287 tropic...
XP_015222462          235 nvtPLTGKNYKQLLDRVEARKAKVEELRSkdeEKAKELEEKIKWTNVLYKAEGLKIKDNEELLRRSLKRKEKMRAQKKRR 314 spotte...
XP_007257025          240 tltPLVGKNYKQLLTRVEARKARLEELREkdeGKAKKEEEKMKWTNVLYKAEGMKIKDDEQLLRASLKRKEKMKTQRKKK 319 Mexica...
Q6DRK9                229 tltPLTGKNYKQLLTRIEARKAHLEQLREkdeGKAKKEEEKMKWTNVLYKAEGMKIKDNEKLLHASLKKKEKMKAQRKKK 308 zebrafish
XP_004074591          224 kltPLTGKNYKQLLSRVEARKAKLEQLKEkdeAKALDFEKKMKWTNVLYKAEGLKIKDDEDMLRTSLMKKEKRRTQKQKK 303 Japane...
WGS:AAWC:PGTG_01427.3 394 WDERIKVVEKLKEDKQKKRTQNIQARKDQIRDKKNG 429 Puccinia graminis f. sp. tritici CRL 75-36-700-3
P70279                301 WEKRSEHVVEKMQQRQDKRRQNLRKKKAARAERRLQ 336 house mouse
XP_002820387          307 WEKRTAGVVEKMQQRQDRRRQNLRRKKAARAERRLL 342 Sumatran orangutan
XP_002195958          305 WEERTVRVVEKMQQRQDKRKKNIQKKKKERIEKKKA 340 zebra finch
XP_005990683          291 WEKRTRTVLEKMQQRQDKRSKNIQKKKRSKVEGRKD 326 coelacanth
Q68F76                288 WDKRTELTAERMQQRQDKRRRNITKKKQAKVNKKKD 323 tropical clawed frog
XP_015222462          315 WEQRSENVLEKMQNRQDKRRKNIQKKKQSKAEKRKD 350 spotted gar
XP_007257025          320 WVERSENVLDKMQQRQDKRRRNIQKRKDNKMEKRQQ 355 Mexican tetra
Q6DRK9                309 WAMRSEQVVEKMQKRQDKRKRNIKRRADAKIEKRKQ 344 zebrafish
XP_004074591          304 WDQRCESVVEKMQHRQDKRKKNLQKRKEVKIEKKKN 339 Japanese medaka
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap