Conserved Protein Domain Family
Med6

?
pfam04934: Med6 
MED6 mediator sub complex component
Component of RNA polymerase II holoenzyme and mediator sub complex.
Statistics
?
PSSM-Id: 398546
Aligned: 120 rows
Threshold Bit Score: 74.0928
Threshold Setting Gi: 74863894
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001646727  10 LQWKSPEWIQAFGL-RTDNVLDYFA--ESPFFEKTSN---NQVIKMQRQFSQMPVMDnpsgntpangggdqqqqqqqqqq 83  Vanderwaltozyma...
EFC50470      34 kTWRDELFLRFRPIvNEDTALEYFCnrSNPFYSKKSV---NETLRMQQTGGIIDRNAl---------------------- 88  Naegleria gruberi
Q8IKE0        17 IEYVDNIFLSKYMLnNIENAMQYFY--TCPFYTSRSKlclNEKIRTGKI------------------------------- 63  Plasmodium falc...
CAQ41432      26 IEYVDNLYLSKNILnNRENALNYFY--TSPFYTSRSHlslNEKIRVGKI------------------------------- 72  Plasmodium know...
Q7RNW7        16 IEYVDNIFLSKNILnNRENALNYFY--TSPFYTSKSHislNEKIRVGKI------------------------------- 62  Plasmodium yoel...
XP_001609351  27 cEFIDPRFLATTALdSNHAALDYFY--QSPFYQKYREgslNELMRAGTE------------------------------- 73  Babesia bovis T2Bo
Q4MZP1        26 IEFIDPQYLSQVTLdNENSALEYFY--LSPFYLKHRNkalNELIRSGLP------------------------------- 72  Theileria parva
XP_006681567   9 MSFKDTAFLQLLGL-NEHNALDYFS--MSQFYDKSCL---NEQLKMQVRHNELQAQQl---------------------- 60  Batrachochytriu...
XP_001581746  12 MAYRNDDFLQMNLLtIGNLFNSYFN--NSPFYDPTCL---NEQVNRYEKFTDIFDE------------------------ 62  Trichomonas vag...
Q54PN3        69 VMWRDPLWLQMYPL-NPQTILQYFS--YSQFYDKNCN---NEQLKMQRLDLSA--------------------------- 115 Dictyostelium d...
XP_001646727  84 sqqsqqqqqsqqsqqqqqqqinifktsvnhqdqdqefgyvdmirrdiltrypmhamlereLGKM-KGVEYVLS------- 155 Vanderwaltozyma...
EFC50470      89 ------------------------------------------------------------LEST-EGIRYSVDs------ 101 Naegleria gruberi
Q8IKE0        64 ------------------------------------------------------------INDDdEGYIFNITydnl--- 80  Plasmodium falc...
CAQ41432      73 ------------------------------------------------------------ISDDeEGYLFDITydnl--- 89  Plasmodium know...
Q7RNW7        63 ------------------------------------------------------------IGEEdEGYLFDISydnl--- 79  Plasmodium yoel...
XP_001609351  74 ------------------------------------------------------------VDSQqVGLIFQVTysnlndv 93  Babesia bovis T2Bo
Q4MZP1        73 ------------------------------------------------------------VDDYqVGLIFKVTynnlpdl 92  Theileria parva
XP_006681567  61 -----------------------------------------------------------dGRQM-KGLEYTLWy------ 74  Batrachochytriu...
XP_001581746  63 -----------------------------------------------------------------NGITYRLTy------ 71  Trichomonas vag...
Q54PN3       116 ------------------------------------------------------------LKNM-DGLEYELI------- 127 Dictyostelium d...
XP_001646727 156 ----------YVREP-----------------------------------DFWIIKKQN-RISSE---STQPLQAYYIIG 186 Vanderwaltozyma...
EFC50470     102 ---------kRSKPP-----------------------------------SLFIIKKEKvEKKDRn--APKLLNLYYIAA 135 Naegleria gruberi
Q8IKE0        81 -------nilKENEPsdfvskh----------------------iyyntnSIFHVSLRQ-KYRLNnvnCTKVIQYFCIVN 130 Plasmodium falc...
CAQ41432      90 -------avlKKNEPedlvsih----------------------iyyntnSIFHISLTH-KYNVKnimCKKIIQMFCILN 139 Plasmodium know...
Q7RNW7        80 -------dvlKKDEPtdsasvh----------------------iyyntnSIYHIRLTH-IYKLKnilFKKVTQMFCVFN 129 Plasmodium yoel...
XP_001609351  94 n--ealanlpPLDEPariqh--------------------------ycnsTLFHITLFS-RNLGQnglTTTPIKVYYIIQ 144 Babesia bovis T2Bo
Q4MZP1        93 yeeslkfganSANKSqfy-----------------------------imsSVFHITLYS-RDLGHnsiENTPINVYYIIQ 142 Theileria parva
XP_006681567  75 ----------FTPQP-----------------------------------SLYVIRKQT-RLSPT---RVDLVAVYYIVE 105 Batrachochytriu...
XP_001581746  72 ---------vQIQEPnflktldpanppkelileteqeiyapekanypittGLCVISKYRtRLQDHgepIKELLAQYYMID 142 Trichomonas vag...
Q54PN3       128 ----------KFVEP-----------------------------------SFFLIAKQT-RISPT---DVLINTLYYVIN 158 Dictyostelium d...
XP_001646727 187 --ANVYQSPTVFKVVQSRLLSTSYHLSSTLKTLRNLIQFE 224 Vanderwaltozyma polyspora DSM 70294
EFC50470     136 eaGVVYQSPSVYDVIQARSFNSLSLLNQTFKEIQPHVEYT 175 Naegleria gruberi
Q8IKE0       131 --GKIYSTLSFGELLTNKINNIVRNINNLFDSVNNMTNFN 168 Plasmodium falciparum 3D7
CAQ41432     140 --GKIYSSRSFGELLNNKIANIVRNVEKFYDCVNNMMNFN 177 Plasmodium knowlesi strain H
Q7RNW7       130 --GKIYSSRSFGELLINKINNIVRNIENFYDRVNNMMNFN 167 Plasmodium yoelii yoelii
XP_001609351 145 --GSIFLCPPFGSLLRHRLHESIQHFENFYDTLNDIVKWS 182 Babesia bovis T2Bo
Q4MZP1       143 --GSIFMCPPFGTLIRTKLHQYIAQFERFYDRINGIMKWS 180 Theileria parva
XP_006681567 106 --GTIYQSPTLCQVLANRVRTSLYFTKDALHVARESYRYN 143 Batrachochytrium dendrobatidis JAM81
XP_001581746 143 --ATIYQAPDLYSLVTSNFRTAIFNLREAIRDADSAYKWT 180 Trichomonas vaginalis G3
Q54PN3       159 --GNIYQAPELHVVFKSRVSQSISHLSEAFNSISSIVNWD 196 Dictyostelium discoideum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap