Conserved Protein Domain Family
XAP5

?
pfam04921: XAP5 
XAP5, circadian clock regulator
This protein is found in a wide range of eukaryotes. It is a nuclear protein and is suggested to be DNA binding. In plants, this family is essential for correct circadian clock functioning by acting as a light-quality regulator coordinating the activities of blue and red light signalling pathways during plant growth - inhibiting growth in red light but promoting growth in blue light.
Statistics
?
PSSM-Id: 398536
Aligned: 92 rows
Threshold Bit Score: 256.768
Threshold Setting Gi: 378726437
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7SBF2       149 VKTKKALVSFGD-D-EEEGE--EeVVVVKKKNAKTPAAEKedtpnpdgsisedkkedtttsTpnressada--------- 215 Neurospora crassa
KDE05791     101 KKEGKVKLSFa--F-DDGEEd----------eSTSKKGTKagddddeeg------------------------------- 136 Microbotryum ly...
EMD38062     104 KKTAKSTLSFa--L-DDEEEggD-G-------ESGsaepega-------------------------------------- 134 Gelatoporia sub...
EGG03727     101 KKKSKYNLSFa--V-DEDEEitVtENKASSSKTESSSTAS---------------------------------------- 137 Melampsora lari...
Q5KGP1       103 KKERTSKLSFa--D-EEEENedetstggvk-------------------------------------------------- 129 Cryptococcus ne...
EED91284     144 KKKRMAALSFa--G-DEELEd----------dETNGADEPsdgkes---------------------------------- 176 Thalassiosira p...
EEH60219     107 KKEMTAKLSFADdElDEENEdeCfLPAAKKAG------------------------------------------------ 138 Micromonas pusi...
Q7RKU2       108 KKHTNFKLSFFSdD-EEEEEd----------eEDEDKNDEnks---------------etpKnksdenslekeqnekeea 161 Plasmodium yoel...
XP_002259504 108 SKKKKLKLSFCSdD-EEENDn----------eDDDDDDNEegdgddygnhrgnrenddkeaKkhsdeaaseeendgaesp 176 Plasmodium know...
XP_001613655 108 SKKKNLKLSFCSdD-EENEE-------------EEEVGEEdgngngdhnrggdqnsgdnerKnhsdegasqeeekdases 173 malaria parasit...
Q7SBF2       216 ---------------------------------dasdnvakKK-------------KIINTSAPIIPralTKAALRREAA 249 Neurospora crassa
KDE05791     137 ---------------------------------tgdedrpsKKak---------lgKNPSIDTSFLP---DREREEAERK 171 Microbotryum ly...
EMD38062     135 -----------------------------------dggrasKRpk---------srKNPNVDTSFLP---DREREEEERR 167 Gelatoporia sub...
EGG03727     138 ------------------------------------------Rkgq--------fgKNPTVDTSFLP---DRDREELDRR 164 Melampsora lari...
Q5KGP1       130 -------------------------------rlredegdahVRkk---------ftKNPGVDTSFLP---DRNRELQEAE 166 Cryptococcus ne...
EED91284     177 -----------------------------------ndkqstKEdkg--------imKNPSVDTSFLP---DQGREQRAKE 210 Thalassiosira p...
EEH60219     139 ------------------------------------------Kfat--------vgKDPGVQTHFLP---DKDREMSERD 165 Micromonas pusi...
Q7RKU2       162 ekssne------------teqinknytdknlqngksvntenKNkpkneendfkkimKDPTVNTSFLK---DKDRDRKIEL 226 Plasmodium yoel...
XP_002259504 177 shernltsegkrskhysdkngsdkndadknlqnkdthtkydKNkpfk------kimKDPTVNTSFLK---DKERDEQIEL 247 Plasmodium know...
XP_001613655 174 pshqrd------------pssegnrnkhdsgkkdsdkngtdKNkpfk------kimKDPTVNTSFLK---DKERDEKIEL 232 malaria parasit...
Q7SBF2       250 EREAIRREFLAKQAAVKASEIAIPFVFYDGTNI--PggmVRVKKGDHAWLFLDKSRkvgaergvgqDKILNARRAWARVS 327 Neurospora crassa
KDE05791     172 VRDELRREWLTKQETMKAEDIEITYSYWDGSGHrkV---VTCKKGDTIAQFLDKC--------------RLQFPELRAVS 234 Microbotryum ly...
EMD38062     168 QREELRQEWLRKQESMKKEDIEITYSYWDGSGHrkS---VMCKKGDEIATFLEKC--------------RQQLPELRGVG 230 Gelatoporia sub...
EGG03727     165 EREELRQKWLKMQEAIKQEDIEITYSYWDGTGHrkE---VTCKKGDSIAQFLEKA--------------RTQWPELRGVS 227 Melampsora lari...
Q5KGP1       167 ERERLRKEWLEQQEKIKAESIEITYSYWDGSGHrkA---VECKKGDDIATFLAKC--------------RQQFPELRGTS 229 Cryptococcus ne...
EED91284     211 ERNRLRREWLDRQKTMKEEVLEITYSYWDGTGHrrT---VHCKKGDTVAQFLELVR----------KDLAKEFREMCNVS 277 Thalassiosira p...
EEH60219     166 VREKLKAEFIAQQEEIKKEKLEITFSYWDGGGHrrK---IEVLKGDTIGIFLGKAR----------ELLSKEFRELRHES 232 Micromonas pusi...
Q7RKU2       227 KKKELRELYFKLENEQKEKDIEITYSYYDGSGHrrK---ILVKQKNTIGQFINKCV----------DNLKHEFTNLRSAS 293 Plasmodium yoel...
XP_002259504 248 RKKELRELYFKLENEQKEKTIEITYSYYDGSGHrrK---ISVKQKTTIGQFINKCV----------DNLKNEFIHLRSAS 314 Plasmodium know...
XP_001613655 233 KKKELRELYFKLENEQKEKTIEITYSYYDGSGHrrK---ISVKQKTTIGQFINKCV----------DNLKNEFIHLRSAS 299 malaria parasit...
Q7SBF2       328 VDDLLLVRGSIIIPHhyefyffiiNKTLGPGNkRLF--DYSddapipsssdpqtsptaadpaalstpssrlaalpDIM-T 404 Neurospora crassa
KDE05791     235 VDNLMYIKEDLIIPHhytfydfivNRYRGKSG-PMFnfDVHed------------------------------vrLIS-D 282 Microbotryum ly...
EMD38062     231 VDNLMYVKEDLIIPHhytfydfivNKARGKSG-PLFnfDVHdd------------------------------vrLLA-D 278 Gelatoporia sub...
EGG03727     228 VADILYVKEDLIIPHhytfydfivNKARGKSG-PLFnfDAHdd------------------------------vrLVA-D 275 Melampsora lari...
Q5KGP1       230 VENLMYIKEDLIIPHhytfydfiiNKARGKSG-PLFnfDVHdd------------------------------vrLIQ-D 277 Cryptococcus ne...
EED91284     278 SDALLYVKEDLIIPQdisfydliaTRARGKSG-PLFnfDVHdd------------------------------vrLGAlD 326 Thalassiosira p...
EEH60219     233 TDGLMYIKEDLILPHtatfydfivNKVRGKSG-PLFhfGVHdd------------------------------vrLKG-G 280 Micromonas pusi...
Q7RKU2       294 CETLMFVKEDLILPNyltfyelikNKAQGKTG-PLFsfDVVed------------------------------lsGIT-D 341 Plasmodium yoel...
XP_002259504 315 CETLMFVKEDIILPNyltfyelikNKAQGKTG-PLFafDAVen------------------------------lcGVT-D 362 Plasmodium know...
XP_001613655 300 CETLMFVKEDIILPNyltfyelikNKAQGKTG-PLFafDAVen------------------------------lsGVT-D 347 malaria parasit...
Q7SBF2       405 LEGANDDPTFTKVVDRRWYQRNKHIYPASTWQEFDPEKDYQNEIR 449 Neurospora crassa
KDE05791     283 ASVEKDESHAGKVVERSWYNRSKHIFPASRWELFNPEVKRDRYTI 327 Microbotryum lychnidis-dioicae p1A1 Lamole
EMD38062     279 ATVEKDESHAGKVVERSWYQRNKHIFPASRWEVYEPDKSYGKYTI 323 Gelatoporia subvermispora B
EGG03727     276 ATVEKDESHAGKVVTRTWYNRAKHIFPASRWEPYVPGKDYGAYKI 320 Melampsora larici-populina 98AG31
Q5KGP1       278 ATVEKDESHAGKVVERSWYNRFKHIFPASRWEVYDPDKDYGSYRi 322 Cryptococcus neoformans
EED91284     327 ARVEKDESHPGKVVERRWYDRNKHIFPASRWEPYDPAKEYGTYTI 371 Thalassiosira pseudonana CCMP1335
EEH60219     281 ANIEKEDSHAGKIIHRTWYDKNKHIFPASRWEQYDPLRPVESYTi 325 Micromonas pusilla CCMP1545
Q7RKU2       342 IRKNKTDTHAGKLVERKWYERNKHIFPASKWEIYKPLTNYGTNYK 386 Plasmodium yoelii yoelii
XP_002259504 363 IRREKTDTHAGKLVEKKWYEKNKHIFPASKWEIYKPMKTYSTGYt 407 Plasmodium knowlesi strain H
XP_001613655 348 IRREKTDTHAGKLVEKKWYERNKHIFPASKWEIYKPMKTYSTSYT 392 malaria parasite P. vivax
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap