Conserved Protein Domain Family
Dynamitin

?
pfam04912: Dynamitin 
Dynamitin
Dynamitin is a subunit of the microtubule-dependent motor complex and in implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS).
Statistics
?
PSSM-Id: 398533
Aligned: 49 rows
Threshold Bit Score: 208.357
Threshold Setting Gi: 300103216
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EXX54758      14 QQDVYETPDSPDEa-----eVSDDGFLNVEEPNED--------IVQDKISLSEAADKFKSNDANGDDSELNritrhkKQI 80  Rhizophagus irr...
Q0UUD3        18 APDIYETPDLAEDvst-iqaSTVVSEDEdge----------saLDRQRFQTDQARNRFQPSRVDAQGVDFS------DNI 80  Parastagonospor...
XP_001938108  18 APDIYETPELAEDvst-iqaSTAVSESEGESDDSAed----saVRHQRLQPDQARNRFQPARIDARGVDFS------DNI 86  Pyrenophora tri...
EGR47774      16 APDIYETPELTDDnst-vptTAARTHSDDEFYGEDdes---qnISRSRLRIDEARSRFSPATIDISGADFS------DRV 85  Trichoderma ree...
XP_013943411  16 APDIYETPELTDDnnstvptTAARTLSDDEF-GEDdes---qnISRSRLRINEARSRFSPATIDISGADFS------DRV 85  Trichoderma atr...
XP_007823431  17 aPDVYETPELTDDnst-vptTANRAQSDDEFYDVDeded-shgISRTRLRIDEARSRFLPANVDANGVDFS------DRV 88  Metarhizium rob...
CCE33077      17 aPDIYETPELTDDnst-vptTTNRAQSDDEFYDVDgddadengISRTRLRINEARSRFLSGNADTNTSRFS------DRV 89  Claviceps purpu...
XP_007791610  16 APDIYETPELTDDtst-vptTAGHSYSDNEFDEDDedd---egISRSRLRIDQARSKFLPSQVDARDVDFS------DRL 85  Eutypa lata UCREL1
EQB45991      16 APDVYETPELTDDtst-vptTTVQSHSDNEF-DDDlddd-ingISRSRLRIDQARSRFLPAGVDATGVDFS------DRV 86  Colletotrichum ...
EFQ35235      16 APDVYETPELTDDtst-vptTTGQSHSDDDF-DDDlddd-tngISRSRLRVDQARSRFLPAGVDATEVDFS------DRV 86  Colletotrichum ...
EXX54758      81 YKKVVNQAFLDTTEYEIVPRDPt------------LQETPVQKLRRLMFEVQELGEEIEKKKDDVASp----qIPQNILs 144 Rhizophagus irr...
Q0UUD3        81 AAQRRSYRTTTRARRRRGEILGdds--------deEQESFEAKLNRVKRELLELENEYERRVETGDKsqieelDPK---- 148 Parastagonospor...
XP_001938108  87 TAQRQSYRTSTRRQRRRGDIIGdds--------deEEESFAKKLLRIKRELAGLEDEYERRVESGDKskieeqDPK---- 154 Pyrenophora tri...
EGR47774      86 DGKRRSYKASSRRQRILQDGTEelgdl----sdddDVESLERKIARLKREVEETKDEYAKRKGAAAGead----gspDD- 156 Trichoderma ree...
XP_013943411  86 DGKRRSYKASSRRQRILQDGTEelgdl----sdddDAESLERKIARLKREVEETRDEYAKRKAAADGdgd----aspGD- 156 Trichoderma atr...
XP_007823431  89 DGKRKSYKASSRRQRILEDGTYelgdl----sdddDDEGLERRIARLKREVEEAKEEYAKRKAATATttaeagGKVLSN- 163 Metarhizium rob...
CCE33077      90 DGKRKSYRASSRRQRILHDGTYelgdlsgddddggDDESLERKVARLKREVEEAKAEYMKRSTTNSGdsqseaIST---- 165 Claviceps purpu...
XP_007791610  86 NGKRKSYKTSNRRQR----AGTeigdl----sdeeDGENLEGKIARLKREIEEAKEEYGRQKSDAQTtap-------vqd 150 Eutypa lata UCREL1
EQB45991      87 DGKRKSYKASTRRQRFLQDGTEeigdl----sdedDEDNLERKIARLQREVEEAREEYGKRKEAAAQagg-----adQE- 156 Colletotrichum ...
EFQ35235      87 DGKRKSYKASTRRQRILQDGTAeigdl----sdedDEVNLERKIARLQREVEEAKEEHRKRKETAAQpap-----eeQE- 156 Colletotrichum ...
EXX54758     145 SHITSLNNELSRIsqsldgdSDDkdGTIiKQAELGKKLIHQLQTFKNMGMPKENGISSgekvngeatngTVDESAKNMVT 224 Rhizophagus irr...
Q0UUD3       149 QQMEYISNKVDSI-------YTMrrGGArGAEAQLDRTVQKFKDYKPF-------------------------DPSPRIT 196 Parastagonospor...
XP_001938108 155 EMMEIIASKVDTM-------YAThkGGArGAQAILDRTVQKFDSYKPF-------------------------EPSPKIS 202 Pyrenophora tri...
EGR47774     157 TRLESLSQTLDDL------------------------------SRRSGITSIQKIEPTgsg-----anePVTEPLEAGPT 201 Trichoderma ree...
XP_013943411 157 IRLESLSQTLDDL------------------------------SRRSGITSIKKIDATssn-----adePSTEVSVAGPT 201 Trichoderma atr...
XP_007823431 164 ERLDTLSQVLDDI--------------------------AKPAGLETSRGMAKTHFPPst--------sKPEVPAGDGPT 209 Metarhizium rob...
CCE33077     166 EGLRSLSHVLDEI--------------------------AKPLGLDSSQAPTNAAVPNsts-----vnqAEGVPAEDGAT 214 Claviceps purpu...
XP_007791610 151 ADLVSLSRALEEI-----------------------TTISEGVIPSATQIARTPREPAne-------aaETPGFQPDGAT 200 Eutypa lata UCREL1
EQB45991     157 EKLGSLSKVLDEL-----------------------SKTIEPHTKSTGVAQPAPQAPKelq-----agsQDALAAGSAAT 208 Colletotrichum ...
EFQ35235     157 EKLGSLSKALDEI-----------------------SRTIALSTSTPSVVQPVSQLPQqqq-----egpHAVLPQRNAAT 208 Colletotrichum ...
EXX54758     225 YELYYSPEN--------TKLHTLAKTNELDERIAALEKLVGTAHGQnfedlsisitNTNLIAAMDKLDQQMQILa--QPR 294 Rhizophagus irr...
Q0UUD3       197 KIVAKQPPLpgtqiqrnQLEYVLNQAADFDKRISQLENNLGLNGNTmpel--sdkpSFPVFTTLQTLEQTLGLLgdaSTN 274 Parastagonospor...
XP_001938108 203 KAIANQPPLpgtqiqksQLEFVLNQAADFDKRITQMENSLGLNGNTmpel--sdhtPFPVSNTLTRLEQTLGLIgdaSTN 280 Pyrenophora tri...
EGR47774     202 YTITYAPTY--------EQTHALAKAADFDRRLLILERSLGISSSSiteag-egglPRAILPTLDSLEKQISTLsqaSTA 272 Trichoderma ree...
XP_013943411 202 YTITYAPTY--------EQTHALAKAADFDRRLLVLERSLGISSSFmpeag-egglPRAILPTLDSLEKQVSALsqaSTA 272 Trichoderma atr...
XP_007823431 210 YTVTYAPTY--------EQSHALAKAADFDRRLLMLEKTLGISASSlsear-anglPRAILPTLDNMEKQISTLaqaSTS 280 Metarhizium rob...
CCE33077     215 YTIKYAPSY--------EQSHALAKAADFDRRLLMLEKTLGIGSSSetetg-snglLRAILPTLDGLEKQVSTLsqaSTS 285 Claviceps purpu...
XP_007791610 201 YTITYAPSY--------EQSHALAKAADFDRRLVLLEQAIGITSSAlpere-nnglPRAIMPTLDTLQKQILTLseaSTS 271 Eutypa lata UCREL1
EQB45991     209 YTVTYAPTY--------EQSHALAKAADFDRRLVLLEKAIGVGSSAlpevd-inglPRAILPTLDGLQKQITTLsqaSTS 279 Colletotrichum ...
EFQ35235     209 YTVTYAPTY--------EQSHALAKAADFDRRLVLLEKSIGIGSTAlpevd-vnglPRAILPTLDGLQKQITTLsqaSTS 279 Colletotrichum ...
EXX54758     295 HLESVSRKAKTLVGELEKVNELKNKELSNggii------------tfeTEEKINYLFALLDKLDPLMSIAPALVNRLKSL 362 Rhizophagus irr...
Q0UUD3       275 NLEGAIQQIRKLTADAEQLKATREDAARTgsvssdg-----tspaypdQEAKINALYGTLPSIDKLSPVLPLILERLRTL 349 Parastagonospor...
XP_001938108 281 NLDAVTQNVKKLTAEAEHLKEVRQEAAQTgsvsgdn-----kvptypdQEAKINALYGTLPSIDKLSPILPLVLERLRTL 355 Pyrenophora tri...
EGR47774     273 NLDTISRRVRALATEQDKLNESREKAKALreelgkhag--spptdtseQEAKINALYAILPAIENLTPILPPLLDRLRSL 350 Trichoderma ree...
XP_013943411 273 NLDTISRRVRALASEQDKLNESREKAKALreelgkhag--sppvdtseQEAKINALYAILPTIENLTPILPPLLDRLRSL 350 Trichoderma atr...
XP_007823431 281 NLDAITRRVRTLASEQDKLNESREKAKALreelgkqg---qsstdaseQESKINALYGILPTIENLTPMLPPLLDRLRSL 357 Metarhizium rob...
CCE33077     286 NLDAISRRVRTLAAEQDKLNETREKAKALreelgkqn---papvdeseQESKIKALYGILPTIENLTPMLPPLLDRLRSL 362 Claviceps purpu...
XP_007791610 272 SLDSISRRVRTLTQEADQLEKSRKAAKAAqdalisqggnaptdaddteQTAKINALYGTLPTIESMTPLLPPLLDRLRSL 351 Eutypa lata UCREL1
EQB45991     280 NLDTISRRVRTLIQEAQELEKARQGAKSAqetlgnggt-pseeaqapeQVAKINALYGTLPTIESLAPLLPPLLDRLRSL 358 Colletotrichum ...
EFQ35235     280 NLDTISRRVRTLIQEAQELEKARQGAKSAqetlgngas-dsegaqppeQLAKINALYGTLPTIENLAPLLPPLLDRLRSL 358 Colletotrichum ...
EXX54758     363 QQLHQEATVFSETINMLSDEQSKIREELKSLDDVTEKLEKSFEINDATVKKNVENMDTRITDL 425 Rhizophagus irregularis DAOM 197...
Q0UUD3       350 RLVHTSAWQADEVLTALEARQSRQEEEIKKWEKQLVIVEKDMEKATTTMHSNMKVVGDDVKKI 412 Parastagonospora nodorum SN15
XP_001938108 356 RLVHTSAWQADEVLSELERRQTAQENEIKNWERQLEIVEKDMKKAETTMVNNIKTVGDDVKML 418 Pyrenophora tritici-repentis Pt-...
EGR47774     351 RAIHADAATASQTLDQIEKQQAEITAEVKLWKEGIEKLEETVSNGDKVMKTNVEVMEGWVKDL 413 Trichoderma reesei QM6a
XP_013943411 351 RAIHADAATASQTLDQIEKQQAEMATEIKQWKEGIEKLENTVTKSDEVMKQNSEVFEGWVKGI 413 Trichoderma atroviride IMI 206040
XP_007823431 358 RAIHADAATASQTLERIETQQAEMTEELKQWKEGLEKMENAMTDGDVTVKGNVKVMEGWVNDL 420 Metarhizium robertsii ARSEF 23
CCE33077     363 RAIHADAATASQTLERIESQQIEMTGELKLWKEGLEKVEHSMKDGETLMKENVKVMEGWIQDL 425 Claviceps purpurea 20.1
XP_007791610 352 RAIHADAATASETLEHLERSQSEMAADIKQWREGLEKIEGAMGEGETAMQTNMQVVEGWVKDL 414 Eutypa lata UCREL1
EQB45991     359 RAIHSDAATASEMLERIERQQTDMATDLKQWKEGLEKVEEAMKEGSTSMAGNMKVMEAWVKDL 421 Colletotrichum gloeosporioides C...
EFQ35235     359 RTIHSDAATASEMLQRIEKQQADMATDLQQWKDGLVKVEEAMKESGTAMTGNMKVMEAWVKDL 421 Colletotrichum graminicola M1.001
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap