2YUF


Conserved Protein Domain Family
NCD2

?
pfam04905: NCD2 
NAB conserved region 2 (NCD2)
Nab1 and Nab2 are co-repressors that specifically interact with and repress transcription mediated by the three members of the NGFI-A (Egr-1, Krox24, zif/268) family of transcription factors. This family consists of NAB conserved region 2, near the C-terminus of the protein. It is necessary for transcriptional repression by the Nab proteins. It is also required for transcription activation by Nab proteins at Nab-activated promoters.
Statistics
?
PSSM-Id: 398529
Aligned: 17 rows
Threshold Bit Score: 185.663
Threshold Setting Gi: 972964477
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2YUF_A        10 LDAAAALSVAECVERMA-----PTLP-KSDLnevkELLKTNKKLAKM---IGHIFEMNDDDPHKEEEIRKYSAIYGRFDS 80 
XP_003244927 240 LDESQITRLATSAKQLV-----QRLP-QYQP----KAQTAKRKANKE---LECVMNMPEEDPRRIESIRKYSAIYGRFDC 306 pea aphid
XP_001845945 218 LTEEQIAKITAKSFQLA-----QTIPqQLEP----RQQNVKKRTTRD---LEQVMAMNESDPRRMDEIRKYSAIYGRFDC 285 southern house ...
EGK96761     382 LTEDQVAKIVQAAERLS-----RTLP-RLEP----RQQSIKKRSARD---LEAVIAMSESDPRRMDEIRKYSAIYGRFDC 448 Anopheles gambi...
XP_015784491 392 LADNQITRLAEAAENLV-----KSLP-PLDL----KLANNKKKSTKDegvLNTIMFMPEDDPKRMKLIRVYAKIYGRFDA 461 two-spotted spi...
XP_011665953 195 LSREIVENIRASAENVVhseglSSLP-------------LNKKITRE---VEYILGMSPDHPNRMEEIHKWSSIYGRFDS 258 purple sea urchin
XP_005469456 222 LDGETARAVVETVERLL-----TTLP-RSDPaevkTLLRMNKKMAKT---VGHIFRMGSQDVNKEEEIRKYSLIYGRFDS 292 Nile tilapia
Q1LWI4       179 LDSAGVQCVMECVERLS-----HTLS-KSDPtevkEHIRTNKKLSKM---IGHICEMSDDDPQKEVEIRKYSAIYGRFDS 249 zebrafish
XP_011604580 185 LDAAAVQSVLECVDRMA-----PGLP-KTDLaevkEQLKNNKKLAKM---IGHILEMNDDDPRREEEIRKYSAIYGRFDS 255 torafugu
XP_016805699 191 LDAAAALSVAECVERMA-----PTLP-KSDLnevkELLKTNKKLAKM---IGHIFEMNDDDPHKEEEIRKYSAIYGRFDS 261 chimpanzee
2YUF_A        81 KRKDGKHLTLHELTVNEAAAQLCVKDNALLTRRDELFALARQISREVTYKYTYRTT 136
XP_003244927 307 KRKPEKPLTLHEVSVNEAAAQICKLVPALLTRRDELFSLARQVVRDSGYHYSKGHS 362 pea aphid
XP_001845945 286 KRRPEKPLTLHEVCVNEAAAQICKYVPALLTRRDELFPLARLVVKECGFGHSASIR 341 southern house mosquito
EGK96761     449 KRRPEKPLTLHEVCVNEAAAQICKYIPALLTRRDELFPLARQVVRDCGFGHSASIR 504 Anopheles gambiae str. PEST
XP_015784491 462 KRNPDKPLTLHEVSVNEAAAQICKHIPVLLTRRDELFPLARQVVRDSGYQYSKGHS 517 two-spotted spider mite
XP_011665953 259 KRKLEKPLTLHEVTVNEAAAQLCNVDPHLILQREKLFPLARQVVRDSGYQYRHGQS 314 purple sea urchin
XP_005469456 293 KRREGKQLTHHELIINEAAAQFCMRDNALLLRRVELFSLARQVARKCAYTSTLKHA 348 Nile tilapia
Q1LWI4       250 KRRDGRQLTMHELTVNEASAQLCIKDLSLLTRRDELFSLARQISREVTYKYSRRSS 305 zebrafish
XP_011604580 256 KRRDGKHLTLHELTVNEAAAQLCMRDVALLTRRDELFGLARQISREVTYKYTYRTS 311 torafugu
XP_016805699 262 KRKDGKHLTLHELTVNEAAAQLCVKDNALLTRRDELFALARQISREVTYKYTYRTT 317 chimpanzee
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap