Conserved Protein Domain Family
Nab1

?
pfam04902: Nab1 
Conserved region in Nab1
Nab1 and Nab2 are co-repressors that specifically interact with and repress transcription mediated by the three members of the NGFI-A (Egr-1, Krox24, zif/268) family of transcription factors. This C-terminal region is found only in the Nab1 subfamily.
Statistics
?
PSSM-Id: 398527
Aligned: 12 rows
Threshold Bit Score: 235.171
Threshold Setting Gi: 123909885
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_013127647 318 RDEPSPKRIKTE-ENFFDIQEALQAIHMRQEMLREQLACAKSKGEETVGRNLQMQLERLLARQMEILQDAAVQERLQALD 396 Nile tilapia
Q1LWI4       312 EDEPSPKRIKSE-DGVYDLQEALQVLHSRQETVREQLAVAKSKGEETIRHSLQVQLDSLLAKQVELLRDAAVQERLKSLD 390 zebrafish
6_pfamImport   2 REELSPKRIKTE-ENISDYQGTHLTLHQQMESLKEQMAIAKAKGEETVAHSLQ---------QLDILRNSE-YDRLQNPE 70 
XP_515992    324 RDELSPKRIKVE-DGFPDFQDSVQTLFQ-Q---------ARAKSEELAALSSQ-QPEKVMAKQMEFLCNQAGYERLQHAE 391 chimpanzee
XP_003217466 398 RDELSPKRIKIE-DGFPDFQDAVQSFYH-QDSVKIQQALSRGKCEDLTALGSQ--PEKMMAKQMEFLCTQAGLER----- 468 green anole
XP_007253295 329 RDEPSPKRIKTEqEGFFDLQEALQAIHMRQETLREQLAQARSKGEETVSRNIQVQLERLLAKQMEILHDAAAQDRLQALE 408 Mexican tetra
XP_005167953 319 RDEPSPKRIKTE-EGCFDLQEALQAIHMRQETLKEQLAHARSKGEETLGRNIQVQLERLLAKQMEILHDAAAQDRLQALE 397 zebrafish
AAF43146      47 RDEQSPKRIKIE-DGYPDFQDTVQTLYQ-QD--KMPLALAKGKSEDPTALNSQ--SEKVMAKQMEFLCNQAALER----- 115 zebra finch
XP_005996609 324 RDEPSPKRIKTE-DGFPDFQEALQILQQKQEALKEQLVLAKSKGeditvhsiqvqLERLLAKQMELLRCPAGQDRLQLSE 402 coelacanth
TNM94036     318 RDEPSPKRIKTE-ENFFDIQEALQAIHMRQEMLREQLACAKSKGEETVGRNLQMQLERLLARQMEILQDAAVQERLQALD 396 Takifugu bimacu...
XP_003446624 318 RDEPSPKRIKTE-ENFFDIQEALQAIHMRQEMLREQLACAKSKGEETVGRNLQmQLERLLARQMEilqdaavqeRLQALD 396 Nile tilapia
XP_029923795 315 RDEPSPKRIKTE-ENFFDIQEALQAIHMRQEMLREQLACAKSKGEETVGRNLQmqLERLLARQMEILQDAAVQERLQALD 393 pinecone soldie...
XP_013127647 397 W----RIPPAALKYLN-NAQNTNGnAAVDASrdsqdERPINLRVVsqnm-------qegDLPLGKQLANELKR------- 457 Nile tilapia
Q1LWI4       391 W----RIPTAALKYLTpTAQHCNSgLSHLSS-----ERPLNLRLS--------------DVPLGRQLANELKR------- 440 zebrafish
6_pfamImport  71 I----CHFSGHYLKNL-ENNSPTT-IASDSSes-qgKFPLNVQIFsaykqqllhhhsenDMPLIETVLNSLYS------- 136
XP_515992    392 R----RLSAGLYRQSS-EEHSPNG-LTSDNSdg-qgERPLNLRMPnlqnrqphhfvvdgE----------LSR------- 447 chimpanzee
XP_003217466 469 -----RLSTGLYRQNS-EEHSPNG-LALDHVdg-qgERPLNLRMSglpnrhlphisldgEPHVVKPLCSELSR------- 533 green anole
XP_007253295 409 W----RVPPGAFKHSA-ERQSTNG-VTSDKSsdqhgEKPLNLHVTrqrag-----asegETPLGKQLANELKR------- 470 Mexican tetra
XP_005167953 398 W----RVPPGPYKHSA-DRQNSNG-LTADKNtepqgERPLNLRVTnqrts-----isdgDTPLGKQLANELKR------- 459 zebrafish
AAF43146     116 -----RLSTGCYRQNS-EEHSPNG-MSLDNAdg-qdERPLNLRMSnlpgrqmqhisldgEQHVGKSLcsdli-------- 179 zebra finch
XP_005996609 403 R----RLSTGLSKQNS-EEQNTSG-LMTESTda-daEKPLNLRISnhqsrqlqqvvaerEHLFGKQQSTELSR------- 468 coelacanth
TNM94036     397 W----RIPPAALKYLT-DIQNTNG-TAAEASrdnhdERPINLRVVsqnm-------qegDLPLGKQLANELKRhhshnns 463 Takifugu bimacu...
XP_003446624 397 WrippAALK----YLN-NAQNTNGnAAVDASrdsqdERPINLRVVsqnm-------qegDLPLGKQLANELKR------- 457 Nile tilapia
XP_029923795 394 W----RIPPAALKYLS-DTQSTNG--AAADSrdtqdDRPINLRVVsqtm-------qegELPLGKQLANELKR------- 452 pinecone soldie...
XP_013127647 458 --------HH---NHNNsnn----sntDETKTPATENGts-----qRASTNAEKKTIKSEPEDS 501 Nile tilapia
Q1LWI4       441 --------HH---KHNTeerhhnqhnsEERVTAATENG--------SQKELLDKKKIKSEPEDS 485 zebrafish
6_pfamImport 137 --------HY---ISTN----------DEKNYAISDGIgilkdysqAALNYTERKIIKLEPEDT 179
XP_515992    448 --------LY---P-------------SEAKSHSSESLgilkdyphSAFT-LEKKVIKTEPEDS 486 chimpanzee
XP_003217466 534 --------LY---AS------------GEAKSQSSEGLgimkdfphSAFSNLERKVIKTEPEDT 574 green anole
XP_007253295 471 --------HH---QAST----------ESKAAAATENGs-------GALNLSEKKTIKSEPEDS 506 Mexican tetra
XP_005167953 460 --------HH---HANA----------ENKMSAATENGgda---ssRALNLSEKKTIKSEPEDS 499 zebrafish
AAF43146     180 ----------------------rlypsGEAKSQSSEGLgilkdfphSAFNNIERKVIKTEPEDT 221 zebra finch
XP_005996609 469 --------FY---YG------------SEGKHQYSENLgmlkdfcqTVLSSTERKVIKTEPEDT 509 coelacanth
TNM94036     464 nnnnnsnhHH---HHHHt---------DESKTPATENGtt-----qRTSSNTEKKTIKSEPEDS 510 Takifugu bimaculatus
XP_003446624 458 --------HH---NHNNsnn----sntDETKTPATENGts-----qRASTNAEKKTIKSEPEDS 501 Nile tilapia
XP_029923795 453 --------HHnhnNT------------DETKTPATENGts-----qRASGNADKKTIKSEPEDS 491 pinecone soldierfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap