6UUS


Conserved Protein Domain Family
RAMP

?
pfam04901: RAMP 
Receptor activity modifying family
The calcitonin-receptor-like receptor can function as either a calcitonin-gene-related peptide or an adrenomedullin receptor. The receptors function is modified by receptor-activity-modifying protein or RAMP. RAMPs are single-transmembrane-domain proteins.
Statistics
?
PSSM-Id: 398526
Aligned: 51 rows
Threshold Bit Score: 144.268
Threshold Setting Gi: 0
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6UUS_E        39 PLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDE 118
NP_001099080  66 HYCWESFVKVMQNVTGAQLCEWKVISRPYSSLQKCLEDHADLLNYSYPNALAESYIFQSHHHYFQNCSAGSQAYFDPPED 145 chicken
XP_002198235  32 EECWKYFVSLMGNVMTSELCEWKVISRPYSALQRCLEDWAESFNYSYPNALAEQYIFQSHHRYFHNCTLEQPVYFDPPED 111 zebra finch
Q867B9        68 QLCWHDYKDYMDSI-KKDWCDWALISRPYSILQECLEQKADAFKLGFPNPWAERIIFEAHRIHFANCSLVQPTFSDPPED 146 pig
AAH69992      81 lPCWYEYKSCMDSV--KDWCNWTLISRHYSDLQNCLEYNADKFGLGFPNPLAENIILEAHLIHFANCSLVQPTFSDPPED 158 house mouse
NP_001166481  48 QLCWADYREHMDLL-EKDWCNWTVISRPYSALRDCLEVEAEVFSLGFPNPLAERVIFETHQLHFSNCSLEQPTLCDPPED 126 domestic guinea...
XP_003414303  67 QNCWLEYKKLMDPL-EKDWCDWAMIRSPYSLLRYCLEHYAEESGLGFPNPWAERAIFKTHQMHFANCSLLKPTFCDPPED 145 African savanna...
PNJ07065      71 QFCWNRYKDQMDSI-EKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSDPPED 149 Sumatran orangutan
XP_014314317  92 SSCWEGYQDVMEDI-KEDWCDWAIISRPYSDLQECLEIEAERFGLGFPNPSAEQIIFKTHQTHFANCSLEETTFSDPPED 170 little brown bat
XP_027301349  62 ERCWEFFVELMRNVTVPQLCDWKVISRPYSLLQECLEGSAEHLNHGYPNALAERFIFQSHHRYFHNCS-VGNQVFDPPED 140 mallard
6UUS_E       119 VLIPLIVIPVVLTVAMAGLVVWRSKRTD 146
NP_001099080 146 VLLAMIIAPICLIPFLVTLVIWRSKDGK 173 chicken
XP_002198235 112 VLLAMIIAPICLIPFLVTLVIWRSKDGK 139 zebra finch
Q867B9       147 VLLAMIMVPICLIPFLVTLVVWRSKDPE 174 pig
AAH69992     159 VLLAMIIAPICLIPFLVTLVVWRSKDSD 186 house mouse
NP_001166481 127 VLLAMIIAPICLIPFFVTLVVWRSKGTE 154 domestic guinea pig
XP_003414303 146 VLLAMIIAPICLIPFLVTLVVWQSKDNE 173 African savanna elephant
PNJ07065     150 VLLAMIIAPICLIPFLITLVVWRSKDSE 177 Sumatran orangutan
XP_014314317 171 VLLAMIIAPICLIPFLVTLVVWKSKDSE 198 little brown bat
XP_027301349 141 VLLAMVFAPICLIPFLVTVVIWRSKDGK 168 mallard
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap