1OFE


Conserved Protein Domain Family
Glu_syn_central

?
pfam04898: Glu_syn_central 
Click on image for an interactive view with Cn3D
Glutamate synthase central domain
The central domain of glutamate synthase connects the amino terminal amidotransferase domain with the FMN-binding domain and has an alpha / beta overall topology. This domain appears to be a rudimentary form of the FMN-binding TIM barrel according to SCOP.
Statistics
?
PSSM-Id: 398524
Aligned: 518 rows
Threshold Bit Score: 223.406
Threshold Setting Gi: 319994881
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1OFE_A                  445 QQQAAFGYTAEDVEmVVVPMASQGKEPTFCMGDDTPLAVLSHKPRLLYDYFKQRFAQVTNPPIDPLRENLVMSLAMFLGK 524  Syn...
WP_014368341            474 avySAFGWDRDGIT-MIESTAETGAEPIRSLGHDSPHAALAWERQNIPDFIKESVAVVTNPAIDRDREMEHFSTRVVVGP 552  Pae...
jgi:Bcell_0985          451 svyaANGWDREHIQ-LIEQMAEKGVEPIRSLGHDAPLAALHPGRKNIADFIKESVAVVTNPAIDRDREMEHFSTRVIIGQ 529  Bac...
jgi:Bsel_2723           451 svyaaNGWDREHIQ-LIEQMADKGVEPIRSLGHDTPLAAMHPGRKNVADFIKESVAVVTNPAIDRDREMEHFSTRVIIGR 529  [Ba...
Q81I86                  448 KEYVAFGWDREHIQ-LLEQMATKGVEPIRSLGHDSPLAALDTDRRNIADFIKESVAVVTNPAIDRDREIEHFSTRTVLGE 526  Bac...
WP_012749207            459 gqYAAFGWDREHIQ-LLEQMAEKGAEPIRSLGHDAPLAAINPNRKNLADFIKESVAVVTNPAIDRDREMEHFSTRTVIGK 537  Geo...
MA:Aflv_0362            445 gqYAAFGWDREHIQ-LLEQMAEKGAEPIRSLGHDAPLAAIDPERKNIADFIKESVAVVTNPAIDRDRETEHFSTRVVVGK 523  Ano...
jgi:B1NLA3E_03410       449 gqYTAFGWERDHIQ-LIEQMAEKGIEPIRSLGHDSPLAALNLGRKNISDFIKESVAVVTNPAIDRDRETEHFSTRTIIGH 527  Bac...
PRJNA212797:N288_05725  444 gqYKAFGWERDQVQ-LVEQMADKGIEPIRSLGHDAPLAALNPERKNIADYIKESVAVVTNPAIDRDRETEHFSTRTIIGK 522  Bac...
Q67SX8                  465 rLMAAMGWSVEDLE-QVAAMARTGAEPIGSLGYDGPLACLAETRQNLADYFKESVAVVTNPALDREREIEHFSTRTVLGV 543  Sym...
1OFE_A                  525 RGNLLE----PKAESA-RTIKLRSPLVNEVEL----------------------QAI-----KTgQLQVAEVSTLYdldg 572  Syn...
WP_014368341            553 RPKVYge------pdArPRVEILYPVVLEGSNgidslae---------lkqpslEQLvnlfgGPnGANVAVLSTTFprg- 616  Pae...
jgi:Bcell_0985          530 RPSLFnk------dvLkTIVQLESPVVAEGKAgkaieke---------ygqpsfEGLfslyeKAn--EAETLNMVRfes- 591  Bac...
jgi:Bsel_2723           530 RPSLFak------sdIrTVIELDSPVIAEGIAgeaiqke---------hrhpslESVidtfsSSk--EFIRLQAVRyed- 591  [Ba...
Q81I86                  527 RPSLLsg------akRpFVVEMLSPIILEGSVaqpiaee---------lhtityEQLielfkTHn--SIATISATFsss- 588  Bac...
WP_012749207            538 RPFLVdk------teTsYVIELSSPILIEGKIgndcate---------lhhpsyDQIvhsfrEKq--LAHILSATFtae- 599  Geo...
MA:Aflv_0362            524 RPSIVsh------eeHpYTVELLSPILIEGKLgnecaem---------lqqpsyDQLvhafeEKq--LAYFISATFveh- 585  Ano...
jgi:B1NLA3E_03410       528 RPTLFsk------eeTdAVIELTTPMLIEGKVgfdcsee---------leqpsyDQLvqfyqDKk--LVTYLSTTFkkg- 589  Bac...
PRJNA212797:N288_05725  523 RPALFHsd-----keVsGVTELQTPLLIEGKAgfecsgi---------iqqpsyDQVtdyyqEQk--LTAYIPIVFsed- 585  Bac...
Q67SX8                  544 RPPIRMrgedDARSLAaTRVELGIPVLLGGERgeplvsravgrrlartagtwllDDLlaafeAGaPGAVRRIAVWFrpt- 622  Sym...
1OFE_A                  573 vnsLEDALTNLVKTAIATVQAGAEILVLTDRpngAiLTENQSFIPPLLAVGAVHHHLIRAG-------LRLKASLIVDTA 645  Syn...
WP_014368341            617 -gsLEAALNELAAEAVRAVKNGAMLVVLDDS---EaHQNDRLWMDPHLAVSKVDIALRAEKlgf-gdnLRRQTTIVLRSA 691  Pae...
jgi:Bcell_0985          592 -etVEEALERLHTQASKAIDNGKTFLVFNDE---GtHVDDKYWIDPHLAISSVDQGLTKEE-------KRRSCSFVLRSG 660  Bac...
jgi:Bsel_2723           592 -esIEEALARLVSEAQEAIESNKSLVLLDDQ---GmHEEDAYWLDPHLAVSAVDQGLTKSR-------HRRDCSLIIRSG 660  [Ba...
Q81I86                  589 -etLQCALSRISSEAIAAVNNGASLLVLDDA---KaHLNERLWIDPHLVTAKVHQALSENK-------LRRNCSLVIRSG 657  Bac...
WP_012749207            600 -etIPQALERLSNEACEAVRSGKTLLVIDDA---EaHQNGNLWIDPLLITSAIDQSLTKQD-------LRRDCSILLRSG 668  Geo...
MA:Aflv_0362            586 -etIPMALNRLSEEACEAAANGKTLLIIDDA---KaHQDGHLWIDPLLVISAIDQALTKAN-------LRRNCSLLLRSG 654  Ano...
jgi:B1NLA3E_03410       590 -etIQAALTRLTDAAIEAVKAGKTLLVLDDA---KaHQQDSFWIDPHLVTSAVDQALVASG-------LRRECSLLLRSA 658  Bac...
PRJNA212797:N288_05725  586 -egIREALGRLAEDAVAAVRSGKSLLILDDS---QaHQNGYLWLDPHLAVSAIDQALVKEA-------VRRDCSILLRSA 654  Bac...
Q67SX8                  623 -etLAQALSRLSAAAVDAVRTGAQVLLLDDG---DaFAGDRLWIDPHLSLSAVDRALHAADgadgrqrLRRRCSLVLRSG 698  Sym...
1OFE_A                  646 QCWSTHHFACLVGYGASAICPYLALESVrqwwldektqklmengrlDRIDlPtalKNYRQSVEAGLFKILSKMGISLLAS 725  Syn...
WP_014368341            692 AIRNLHDIAVACGLGADVLSPYIMFATA------------------ASKDgApaaRKVFTALMKGLEKVISTIGTHELRG 753  Pae...
jgi:Bcell_0985          661 SIRSLHDIAVVFGLGADVVNPYVMFASV-------------------VNGdVepaGKLYSALNKGLEKVISTIGIHELRG 721  Bac...
jgi:Bsel_2723           661 SIRSLHDIAVIFGLGADLVLPHIMFSTA-------------------IDEdGtpaVKLFEALNKGLEKIISTIGIHELRG 721  [Ba...
Q81I86                  658 ALRSLHDIVTLYGLGADGINPYLLFATV-------------------NDGtKtpiTNLYTALNKGLEKVISTIGIHELRG 718  Bac...
WP_012749207            669 AIRSLHDFVVAYGLGANAISPYLMFATV------------------ASEEsTapvANLFKALNKGLEKVISTIGIHELRG 730  Geo...
MA:Aflv_0362            655 AIRSLHDFIVAYGLGANVISPYLMFATV-------------------ADTsTrpaIHLYQALNKGLEKVISTIGIHELRG 715  Ano...
jgi:B1NLA3E_03410       659 AIRSLHDIMIAIGLGANVISPYYMFMTI-------------------HDEsLtpvKNLYTALTKGVEKVISTIGIHELRG 719  Bac...
PRJNA212797:N288_05725  655 SIRSLHDIITSYGLGADLISPYYMFMTV-------------------LDEsAtplVNLYTALTKGLEKVISTIGIHELRG 715  Bac...
Q67SX8                  699 ALRSLHDVALALGLGADAVNPYLMLEAAa----------------qAAPApEeglANLLAALRKGMEKVISTLGIHELRG 762  Sym...
1OFE_A                  726 YhgAQIFEAIGLG 738  Synechocystis sp. PCC 6803
WP_014368341            754 Y--TRFFSSIGLk 764  Paenibacillus mucilaginosus
jgi:Bcell_0985          722 Y--GRLFSAMGLN 732  Bacillus cellulosilyticus DSM 2522
jgi:Bsel_2723           722 Y--GRLFSSMGLH 732  [Bacillus] selenitireducens MLS10
Q81I86                  719 Y--GRLYSSIGLh 729  Bacillus cereus ATCC 14579
WP_012749207            731 Y--SRLFSSIGLH 741  Geobacillus sp. WCH70
MA:Aflv_0362            716 Y--SRLFSSIGLH 726  Anoxybacillus flavithermus WK1
jgi:B1NLA3E_03410       720 Y--GRLFSAIGLN 730  Bacillus sp. 1NLA3E
PRJNA212797:N288_05725  716 Y--GRLFSSIGLH 726  Bacillus infantis NRRL B-14911
Q67SX8                  763 Y--ARCFSHIGLr 773  Symbiobacterium thermophilum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap