Conserved Protein Domain Family
Nre_N

?
pfam04894: Nre_N 
Archaeal Nre, N-terminal
This conserved region is found in the N-terminal region of archaeal Nre proteins. While most archaeal organisms encode only a single Nre protein, some encode two, NreA and NreB.
Statistics
?
PSSM-Id: 398521
Aligned: 81 rows
Threshold Bit Score: 258.994
Threshold Setting Gi: 74561547
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ELY37620        21 LAREKSYGITQYLDEVEDRFSEAl-sGESLVGSTAPSIFVGHSNYPRVSTG-LLSPVGDedRAAEYATDGAWYrqGLSID 98  Halalkalicocc...
BAJ50400        25 LCKLSTCPFYRDLFKEALAAKLS---GRQLSGPSPPTFLVGEKGYPRVALGsALVYADDi-NPALLESPSKWL--DFSVN 98  Candidatus Ca...
EQB69219        44 LCGLGYCPIIKNLKSSGLELKMV---SGDAEADTPPGIFVGSYGYSEVLAGpTALF-----NPDVFDYGKERF--GMKLE 113 Thermoplasmat...
WP_014026890    20 LCGLPQCPILARFRAQVFAVAKIt-sGDVVEGDTPPSLVVGEEGYPRVPVLyQVPPGEQgdSAKWHDDPVDWAgkRVKLD 98  Pyrolobus fum...
imbp:Hbut_1218  19 LCGLPYCPILERFRQQVLASSRIt-gSREVEGDSPPSIVVGEAGYPTVPILyNLPPEEHgeKARLHDAPLDWArqRLPLR 97  Hyperthermus ...
Q9YAE1          18 LCGLPSCPILDRLRSQARSLERAr-wSREVQGSTPPSILVGERGYPGVRLYyMVPPGVAgpEAQRYEDPLGWRssRTPLG 96  Aeropyrum pernix
WP_013266237    18 LCGLPRCPILERFRVQVNAVQRIn--GKDVVGSTPPSVLVGEYGYPKVSFYyMVPPGKSsdEAAYYDAPKLWAerRETLG 95  Acidilobus sa...
WP_015232945    18 LCGLPKCPILEEFRARVNSSLKIs--NKDVNGSTPPSGIIGEYGYPKVLFHyMVPPGLSgdKAKYTDNPVLWSikKEPLD 95  Caldisphaera ...
jgi:Msed_1702    9 LCGLSSCPITERFRAVVNATSRIsldKGVVDGSTPPSAVVGEKGYPRVSLSfNLAPGVVgdQARVYEDPVNWWg-KATIY 87  Metallosphaer...
jgi:Kcr_1144    19 LCGLKRCPIVERIKFSTRLd-----fGRLIDGFTPPSSLVSERGYPRVLVGpTVSQI----EPDLPENPKFWI--SKDLS 87  Candidatus Ko...
ELY37620        99 DVVQLRTGLLNANRFTDVRSAGgntavrgsgtpavhdvWDGFiGTQREVAIADRPVDVEIG---LSDS-RlDFDLPDDDT 174 Halalkalicocc...
BAJ50400        99 ELLRLRLSLLLGLTITHVKTPIq--------------rRDPF-TALQESAASIKPVDFEIT---TAGA-V-KTMPGFSIR 158 Candidatus Ca...
EQB69219       114 EVISMNSNVYRTASKMSIRRPD-----------------EKFhEYILESASSIKPFEIAFKtehFSMHgP-DTGDFFD-- 173 Thermoplasmat...
WP_014026890    99 VILELRSRLVGGVERLDVRQPWvl-----------------yeKEIGLAAVSETPVSSEVL---LARR-P-VPRLVFDGM 156 Pyrolobus fum...
imbp:Hbut_1218  98 TIISYRSSLVSGVKRVQATTPWkl-----------------yeEEISVAAVSTKPVQSRAL---LEKP-P-IPSLRFDGV 155 Hyperthermus ...
Q9YAE1          97 SIVRLRSELVAGVLRADARRPHell----------------yqREIGPAALSERPVDSFLE---LARL-P-VPRVSFDGY 155 Aeropyrum pernix
WP_013266237    96 NIVKLRGEMVSAYVRLDVNEPWrl-----------------yeTELGLASLSERPVESDVL---LKSL-P-LPQLKFDGM 153 Acidilobus sa...
WP_015232945    96 NIVKMRSELVSATIMVDINRPWel-----------------yqNEIGLAIISERPVDSEVL---LKKE-P-LPKLSFDGI 153 Caldisphaera ...
jgi:Msed_1702   88 DIINYRSSLISNFSSIQVTDVWkl-----------------yeRELSLAVVSERPVQSESK---ISGK-L-EAKLRFDGY 145 Metallosphaer...
jgi:Kcr_1144    88 YIIARFSSQIYANFRSHIRNID-----------------DPRlEELRFSAMSYSPVGINVE---LVRI-P-KPRVSFDGI 145 Candidatus Ko...
ELY37620       175 AAPRGPRTGAESATLTENPHVPRAVEKTLEDDDWRAEGAMAYLYRRGFDVYEINRILSAGALGEAETRRLVPTRWSITAV 254 Halalkalicocc...
BAJ50400       159 TAPYGPSARVEKVKLTGNVSIPRKVDSYLNDPYVKAEETLTSLYKTGHDEYYLTRLFSAGLLGIASQRKLVPTEWSITAV 238 Candidatus Ca...
EQB69219       174 -TPVGSTAMVSNLRVTGNPKIPRMVDYIHGDNDLKSSEGLFKLFQEGFQPEYLQNILAGGLIGIDHQRKMVPTRWAITAT 252 Thermoplasmat...
WP_014026890   157 TAPQGPAAPAREIRVTGNPKPPRKIEKLVFD-DAPAADGVWEAYRAGVDYYALIRAFSAGFIGRLRSRRLVPTRWAITAV 235 Pyrolobus fum...
imbp:Hbut_1218 156 LAPQGPAAPARKVIVESNPTLHPKLEKLIWD-DARSDEAVYELYRSGVDVYTIVRAFSLGLLGRVRSRRLVPTRWSITAV 234 Hyperthermus ...
Q9YAE1         156 TKPVGPTAPARRVEVEGNPRLEKPVERAIWE-DEKAEVMAWELFNRGVNVYTIQRALSIGFLGRLRARRLVPTRWAITAV 234 Aeropyrum pernix
WP_013266237   154 TKPMGPRAPAEKVIVSGAPKLQRKAEEAIWD-DAKAEDIIWELYQAGVDVYKIQDMLSLGFLGRLRARKLVPTRWAITAV 232 Acidilobus sa...
WP_015232945   154 TKPIGPKAPAEKIIVRDNPKLNITTEKIIWD-DLKAEKAIWKIYSSGIDIYTIQNMLSLGFLGKVKNRRLVPTRWSITAV 232 Caldisphaera ...
jgi:Msed_1702  146 VLPRGPSVKAEEIRVVENPKVPRMLEKLIQD-DVKATEGVVSLYESGQDIYRIIDALSLGLLGTRKGRKLVPTRWAITAV 224 Metallosphaer...
jgi:Kcr_1144   146 LAPIGPSAPAERIKLTENPKIPSSLERAFYDSDVRASEIIWETYNRGVDVYAISKILSLGGLGNRARRKLVPTKWAITAT 225 Candidatus Ko...
ELY37620       255 DDTVGKFLRGSIRSNPSVD-ETRVFSSEYMGNRYWAILSPGNWEFELVEMKAP 306 Halalkalicoccus jeotgali B3
BAJ50400       239 DDILSKQLYNQVRQYSIIN-EYRVHSYSAVENSATVVLTPTPWMYELLEGWLR 290 Candidatus Caldiarchaeum subterraneum
EQB69219       253 DDILFKELKKDIIHSPWIS-DITQFNMNYVGNSFQVVLFPGPFSFEMLEQWNR 304 Thermoplasmatales archaeon Gpl
WP_014026890   236 DSIIGSRLRSLIATGNELG-QVELYKAYYLGNRFIVILAPGPLRVEMIEVWHP 287 Pyrolobus fumarii
imbp:Hbut_1218 235 DQIISTRLLHRVRTYDTLG-RVEVYHAHYLGNYITVILFPGSYEAELIEVWHP 286 Hyperthermus butylicus DSM 5456
Q9YAE1         235 DEMLSRRLRRLLKTAPEIG-GVEVYFSEYLHNRFLIILKPGPGWMEWIEIWHP 286 Aeropyrum pernix
WP_013266237   233 DDIISRRLRREVRDFRSVD-SVEAREAEYLGNRFLVILMPGEGTFEWIEVWHP 284 Acidilobus saccharovorans
WP_015232945   233 DDIISNELRKKIRDFNEIN-AIMAFEGEYLSNRFLIIFIPGEGSFEWIEVWHP 284 Caldisphaera lagunensis
jgi:Msed_1702  225 DSIVGKELYDRVVSLPAIN-EVLVFYQGYLGNHFHVILYPSSYSISWVEIWHQ 276 Metallosphaera sedula DSM 5348
jgi:Kcr_1144   226 DSIIGDFLRREIEYLPIYSgEVMLFQSNYEGNRYFVLIAPGPYMLEIVEAWMP 278 Candidatus Korarchaeum cryptofilum OPF8
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap