Conserved Protein Domain Family
NifQ

?
pfam04891: NifQ 
NifQ
NifQ is involved in early stages of the biosynthesis of the iron-molybdenum cofactor (FeMo-co), which is an integral part of the active site of dinitrogenase. The conserved C-terminal cysteine residues may be involved in metal binding.
Statistics
?
PSSM-Id: 398518
Aligned: 54 rows
Threshold Bit Score: 167.771
Threshold Setting Gi: 357941040
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q13N51          21 ALAGVIAGAFERHGLdALPMPGLDADQTRRMFARWF-PGAGPAlgla---wlsWSAPASGRREEPREDELDDLVALLNDH 96  Paraburkholde...
jgi:Metme_1627  32 WLAQIIASWLVGDGA-LPDRLGLNESQFRQLLKQHF-SGHELL----------EQAPSGTNLDFSRMLEKQDLEQLLRQF 99  Methylomonas ...
jgi:Tola_0606   27 WLTQLVWRFQTGISQ-LPRYMGLGAEPYQQLLVTCNvPSAVIGll------qhQRQTLLSELLAMREQECQELEQWLSDY 99  Tolumonas aue...
KFC99561         7 WLSRLLSLHLTGRSR-FPPQMGLGDVAWQALLQHTGrAAPVLStl------qfEQQKLLGLLQQARTCEREQLAQWLAQS 79  Rahnella aqua...
WP_013319619     7 WLRRLLTLHDAGAAC-FPRRMGLDEAAWLALRQRLNqPAPGANaa------rdQRQSLMSELQQSRREERAQLAGWLYGY 79  Dickeya dadantii
WP_015818508    27 FLATILIAQRTGQGC-LPYTLGLRDEDYQTMLETYF-SAIRGMidsp--gnfrEQHAIRQELLELRSQEFGELTELLVQN 102 Teredinibacte...
WP_011912482    18 WLAQIIRAQREGRSC-LPQHLGLDAAQYAELLTRH---GLRPPsrsadeallgERDALREELLALRREEWQALHDLLLGG 93  Pseudomonas s...
jgi:Hhal_0280   36 PLAQLVAAWLSGESV-LPAWMGLEPGDYVAMMARHF-PGVGAV----------TPFPDPPTLARPLADEQADVADLLLRY 103 Halorhodospir...
Q47G34          34 LLASLIAGQTSGGGC-LPPHLGLGPAAYRYLREAYF-PGCT---------------ATPTAREIESIPEWDDLQKLLLDH 96  Dechloromonas...
WP_011764264    32 FIAHLIAGWTLGDGV-LPADLGLGASRFARLMAVHF-PGLA------------WEPKPDHGPALVLYPEFDDLVRFIGAH 97  Azoarcus
Q13N51          97 ADPHAGTpdeANCVAHALACASLGQNHLWQDLLLPSRRELSALIGHWFPRLAAKNTHDMKWKKFFYKQLC-EREDLFICK 175 Paraburkholde...
jgi:Metme_1627 100 SSAEHAE---TEWLIAIIVAACLGSDHLWQDLGLWSRQELSAMLRHNFPQLAERNSKDMKWKKFLYKQLC-EAEGLFVCR 175 Methylomonas ...
jgi:Tola_0606  100 LLPDAAP------MARIIAVASMGYNHLWQDLGLDTRQSLRELMQCCFPDLVQMNSQNMRWKKFFYRQQC-ALGGNYVCR 172 Tolumonas aue...
KFC99561        80 QVPEAAP------MHELIATASMGFDHLWQDLGLDSRAELRDLMTDCFPELVRMNHQNMRWKKFFYRQQClQSLGEIVCR 153 Rahnella aqua...
WP_013319619    80 QVADGAP------MHQLIASASLGFNHLWQDLGLDSRAELRLLMSDCFPELVALNHHNMRWKKFFYRQRClHQDGELVCR 153 Dickeya dadantii
WP_015818508   103 SQGVHAS---EAWLAQIIAAGCMGGDHLWRDLGLVNRESLRAMFVENFPDLAEKNNANMRWKKFLYRQLC-ETGGHFVCR 178 Teredinibacte...
WP_011912482    94 Q--DDHG---EPAMAAIVAAACLGGEHLWRDLGLASRAQLYALLMHNFPQLARRNTQDMRWKKFLYKQLC-EQDGGYVCR 167 Pseudomonas s...
jgi:Hhal_0280  104 RRGADRS---ERWLAQIVAAGCLGRDHLWQDLGLRSRKELTRLMQAGFPALCALNDRDMKWKKFLYKRLC-EETGIYTCR 179 Halorhodospir...
Q47G34          97 RARKSPS---ELLMANIVATACIGRDHLWQDLGLASRDELSQLMWVNFPELARANTGDMKWKKFLYRQFC-SREGIYVCP 172 Dechloromonas...
WP_011764264    98 ADPTVAG---ADDMTLVLATACMGSDHLWQDLGLPSRRELSQLIALNFPELGALNNRDMKWKKFLYRELC-QREGIFVCA 173 Azoarcus
Q13N51         176 APSCGVCSDHALCFG 190 Paraburkholderia xenovorans LB400
jgi:Metme_1627 176 APSCEVCQDYPQCFG 190 Methylomonas methanica MC09
jgi:Tola_0606  173 SPSCDECVEREGCFA 187 Tolumonas auensis DSM 9187
KFC99561       154 SPSCNECCEWHTCFA 168 Rahnella aquatilis CIP 78.65 = ATCC 33071
WP_013319619   154 SPSCDDCCEWALCFA 168 Dickeya dadantii
WP_015818508   179 SPSCETCPTYDECFG 193 Teredinibacter turnerae
WP_011912482   168 SPSCEACPTYHDCFG 182 Pseudomonas stutzeri
jgi:Hhal_0280  180 APSCDACSDFSECFG 194 Halorhodospira halophila SL1
Q47G34         173 APSCGVCKDYAKCFG 187 Dechloromonas aromatica RCB
WP_011764264   174 SPSCESCADYANCFG 188 Azoarcus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap