Conserved Protein Domain Family
TH1

?
pfam04858: TH1 
TH1 protein
TH1 is a highly conserved but uncharacterized metazoan protein. No homolog has been identified in Caenorhabditis elegans. TH1 binds specifically to A-Raf kinase.
Statistics
?
PSSM-Id: 398497
Aligned: 11 rows
Threshold Bit Score: 694.168
Threshold Setting Gi: 144579117
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q29GI5            2 EVEYEDSG--WQGRAK--------AQSNSEEVhEDNPQKTIQECLEKFLTPDYIMEPGIFTQLKRYFQSGGSPEEVISML 71  Drosophila p...
XP_011252244      2 ESDYDEDRsgWGDEMNr------sDDCSGEDT-FDNPQEVLNECLDKFKTPDYIMEPGIFAQLKRYFQAGGNPEQVIELL 74  Florida carp...
OWR53707          2 PSQYDEERv-WEGQNQnh-----yEDDGTEDV-IDNPEEVLQECLEKFKTPDYIMEPGIFGQLKRYFQAGGNPEQVIEQL 74  Danaus plexi...
EFA00603          2 DEEYDERN--WDTVDRld-----nDSDAGDET--ENPEQVLKECAEKFSTSDYIMEPGIFSQLKRYFQSGGNPLQVIEEL 72  red flour be...
XP_001944110      2 EDDYDEYRr-WDGDVDv-------EADDNDDI-LENPEETLTQCLEKFSSADYIMEPGIFSQLKRYFQVGGTPEHVIELL 72  pea aphid
EFX85644          2 dDGYDNQD--WGESSGmrgdsemgDSDNEDQY-MENPAEVLEECLQTFKTQDYIMEPGIFNQLKRYFTVGGSPAHVIELL 78  common water...
Q922L6           11 GEDYFGNAseWGEEADggq---hqEDDSGEG---EDDAEVQQECLHKFSTRDYIMEPSIFNTLKRYFQAGGSPENVIQLL 84  house mouse
EDV25448          8 DNEYESYY-----NAGdfqeeqpdNDHNADD---EDTMTVIEECKRKFSNDDSVMESDLIVHIRKYIKAGGTPEELVQLL 79  Trichoplax a...
jgi:OSTLU_93007   2 SDDDEVCT--RTATASdgegtragESGAIAAL-GETKTSRLMELEARLAEKDFIMEPSAIDDVRAYVSAGGAPSTAIELL 78  Ostreococcus...
XP_002431657      2 EDDYDEDKg-WEGDGGd------gDSEGGEEA-LENPQEVLTECLEKFSTPDYIMEPGIFTQLKRYFQAGGNPEQVIDLL 73  human body l...
XP_310712         2 EEEFEDEA--WNNSAGrgna-peeEVENHEEP-SENPKAVVSDCLQLFSSVDYIMEPGIFVQLKRYFQAGGTPEQVINTL 77  Anopheles ga...
Q29GI5           72 SENYKAVAQMANLLAEWLILA-----GVKVTDVQAMVENH---------------------------------------- 106 Drosophila p...
XP_011252244     75 SKNYTACAQMANLLAEWLILA-----GVKVTDVQAMVENN---------------------------------------- 109 Florida carp...
OWR53707         75 SINYNAVAQMANLLAEWLILG-----GVKVTEVQAMVENH---------------------------------------- 109 Danaus plexi...
EFA00603         73 SQNYTAVAQMANLIAEWLITG-----GVNVTSVQAMVENH---------------------------------------- 107 red flour be...
XP_001944110     73 SKNYIGVAQMANMVAEWLILG-----GVAIGEVQSFVENH---------------------------------------- 107 pea aphid
EFX85644         79 SQNYSASAQMANLMAEWLILA-----GATINDVQSMVENH---------------------------------------- 113 common water...
Q922L6           85 SENYTAVAQTVNLLAEWLIQT-----GVEPVQVQETVENH---------------------------------------- 119 house mouse
EDV25448         80 SDHYIGEGEVANAYIKWLQDL-----GVKDETINRTCVEH---------------------------------------- 114 Trichoplax a...
jgi:OSTLU_93007  79 SENYRGYAAMTTLAVHWLKVTapprrGANTSPIKVSAAVEtrgidngdgdatrtptggiltsgagkgtpreraatmetea 158 Ostreococcus...
XP_002431657     74 SQNYSATAQMANLLAEWLISG-----GVNVTAVQAMVENH---------------------------------------- 108 human body l...
XP_310712        78 SANYTAVAQTANLLAEWLIMA-----GVRVTDVQAMVENH---------------------------------------- 112 Anopheles ga...
Q29GI5          107 -------LKEMILKSFDPKKADTIFTEEGETPDWLTEMIDHYTWRSLIYRLAEEYPDCLMLNFTIKLISDAGFQSEITSI 179 Drosophila p...
XP_011252244    110 -------LKDMILKTFDPKKADKIFTEEGETPAWLTEMIQHPTWRSLIYRLAEEYPDCLMLNFTIKLISDAGFQGEITSI 182 Florida carp...
OWR53707        110 -------LKDMILKTFDPKKADTIFTEEGETPAWLTEMIEHPTWRSLIYRLAEEYPDCLMLNFTIKLISDAGFQGEITSI 182 Danaus plexi...
EFA00603        108 -------LKEMILKTFDPKKADTIFTEEGETPAWLTQLIEHPTWRSLIYRLAEEYPDCLMLNFTIKLISDAGFQAEITSI 180 red flour be...
XP_001944110    108 -------LKDMVLKTFDPKKADTIFSEEGETPAWLTEMIEHKIWRSLIYRLAEEYPDCLMLNFTIKLISDAGYQGEITSI 180 pea aphid
EFX85644        114 -------LKEMIIKMFDPKKADTIFTEEGETPAWLTEMIEHPTWRSLVYKLAEEYPDCLMLNFTIKLISDAGFQGEITSI 186 common water...
Q922L6          120 -------LKSLLIKHFDPRKADSIFTEEGETPAWLEQMIAHTTWRDLFYKLAEAHPDCLMLNFTVKLISDAGYQGEITSV 192 house mouse
EDV25448        115 -------LREVVISKFDPAKADSLFIGEGKNVTWLQDMIAQPFWRNLFYCLAERFPDCLVCKFAVRLISDAGYQDDINNI 187 Trichoplax a...
jgi:OSTLU_93007 159 rfdemyfLEALVREKFDANKADAVF--QGRPPAWLDGLFKSERGRAVLFSLAERNPNCLLISCAIQHAWQRGMRHEVRAL 236 Ostreococcus...
XP_002431657    109 -------LKDMVLKTFDPKKADTIFTEEGETPAWLTEMIEHPTWRSLIYRLAEEYPDCLMLNFTIKLISDAGFQGEITSI 181 human body l...
XP_310712       113 -------LKDMILKTFDPKKADKIFTEEGETPGWLTEMIEHHTWRSLIYRLAEEYPECLMLNFTIKLISDAGFQSEITSI 185 Anopheles ga...
Q29GI5          180 S-TAAQQIEVFSRVLKTSIVKFLNNPDDVHGA---IQECARMVCHGQHTYVYSQVLIQVLSQEQKGGFN------MKRLS 249 Drosophila p...
XP_011252244    183 S-TAAQQIEVFSRVLKTAIAGFLENTENWQSS---IQECAKMVCHGQHTYVYSQVLLQILAQESRGGFM------MKRLS 252 Florida carp...
OWR53707        183 S-TAAQQIEVFSRVLKSAIVGFLQSSDQWQNS---VTECAKMVCHGAHTYVYSQVIVHILSQEPRGGAI------MKRLN 252 Danaus plexi...
EFA00603        181 S-TAAQQLEVFSRVLKTSIASFLTNPEDWQNT---SKECAKMVCHGQHTYVYSQVIIHVLARESKGGSS------MKRLS 250 red flour be...
XP_001944110    181 S-TASQQIEVYSRILKNFITESIKTSSENRQNt--IQECAKMVCHSQHTYVFTLVALQVLAKETNGGVN------MKRFS 251 pea aphid
EFX85644        187 S-TAAQQIEVFSRILKTSVGQYSESNDDDRQKh--IQECARMICHGQHTFVYSEVLLNVLSQEPKGGPS------IKRLS 257 common water...
Q922L6          193 S-TACQQLEVFSRVLRTSLATILDGGEENLEKn--LPEFAKMVCHGEHTYLFAQAMMSVLAQEEQGGSA------VRRVA 263 house mouse
EDV25448        188 S-TVCQHLELFTRQLQSCVHSVIAKGPTTSSAd--VDNMINMACHTEHGYLCCQFFLRILLYDIENSHL------IRFLM 258 Trichoplax a...
jgi:OSTLU_93007 237 GpAAAAYFSIFHELLADHVKGIIEAGDDDERRmdfEERLKSMCCQSIGTYVFGQLMLATLGRDTDKATTkssqaiAARLS 316 Ostreococcus...
XP_002431657    182 S-TAAQQIEVFSRVLKTAISGFLTNADDWQKN---IQECGKMVCHGQHTYVYSQVLLQVLSQETKGGSN------MKRLS 251 human body l...
XP_310712       186 S-TAAQQIEVFSRVLKTAIAKFLSHPEDWQGA---IEEVAKMVCHGQHTYVYSQVLIQVLSQEAKGGFI------MKRLS 255 Anopheles ga...
Q29GI5          250 QEIIKYALQNNQNVTPITMA--LNGSAVYPQACQALTSMLTR----------------NTLNPADITVLFRNYSGSD--- 308 Drosophila p...
XP_011252244    253 QEITKCAQQNRHDVTPITMA--LNGAASSPGACQALASMLSR----------------NTLNPADITVLFRNFSTSE--- 311 Florida carp...
OWR53707        253 QEITRCAQESGHDVTPITLA--LTPGESWRNARTALAAMLSR----------------GALNPADITVLFRAYTQPD--- 311 Danaus plexi...
EFA00603        251 QEITKCAQKNGHDVTPITMA--LNGASAYPLACQALTSMLSK----------------NTLNPADITVLYRNYNAPD--- 309 red flour be...
XP_001944110    252 QEITRCAQERN-DVTPITMA--LNGAAPYDQPCAALSSMLSR----------------NALNPADINVLHKHYSSAD--- 309 pea aphid
EFX85644        258 QEITRHAIQSGHNVTAIIMG--LNGSAAHPRASQALSSMLSR----------------NALNPADITNLYKLYSATD--- 316 common water...
Q922L6          264 QEVQRFAQEKGHDASQITLA--LGTAASYPRACQALGAMLSR----------------GALNPADITVLFKMFTSMD--- 322 house mouse
EDV25448        259 QKIESGAISRGLAVSDIAMI--VNGVYQYTNVNAAVNNIFSR----------------NALDSTDVATLYEVYSGDE--- 317 Trichoplax a...
jgi:OSTLU_93007 317 EEIEEAAASLHGAATVRRLApwLAASAADATAKYATADLLSSrpvgtntssvgqirdsGALAAGDLKKLLDLYVSSDvkk 396 Ostreococcus...
XP_002431657    252 QEIIKCAQKNHHDVTPITMA--LNGATQYPQACQALTSMLSR----------------NNLNPADITVLFRNYSAPD--- 310 human body l...
XP_310712       256 QEITKYALKNNHNVTPITMA--LNGSSRHPQACEALTSMLSR----------------NTLNPADITVLYRNYTSPE--- 314 Anopheles ga...
Q29GI5          309 PPPIDLIRNPQFLELLVDALFR--SGVKINPEHKPKYMFLLAYASAVIDQPAKKrp-lTERTLNKDELKSTIQAIEKAHA 385 Drosophila p...
XP_011252244    312 PPPIELLRNPQFLELLVDALFK--PGVKINPEHKSKYIYLLAYAASVCETTKKG----NTRKINKDELKTTIQAIEKVHN 385 Florida carp...
OWR53707        312 PPPVHLLRIPHFLELLVDSLFK--SGSKLNPEHKPKYMHLLAYAASVCEGPAPG------RPI-KDELKATMQAIEKIHT 382 Danaus plexi...
EFA00603        310 PPPIDLIRTPQFLELLIDALFK--PGVKLNPDHKPKYIHLLAYAASVYEMQAKKg---QKRVVNKDELQATIHSIETVHN 384 red flour be...
XP_001944110    310 SPPVSLLRIPQFLELLVQALFK--PGMKLNPEYKPKYIYLYAYSASVYEVTSGK----KRKIINKDDLKSTIQAVDKVHS 383 pea aphid
EFX85644        317 PPPVELIRLPQFMELLLDSLFK--PGVKLNPEHKSKYNYLLAYAASVAEVYKKN----QRKNTNRDELKATMQALEKAHQ 390 common water...
Q922L6          323 PPPVELIRVPAFLDLFMQSLFK--PGAKINQDHKHKYIHILAYAASVVETWKKN----KRVSIGKDELKSTSKAIETVHN 396 house mouse
EDV25448        318 PPPIEIIRHPRFLDLLIKRLFD--PDDKIDADLKSKLCFLLAYAVSVVETISET-----QTLLNTDDLKSTTNVIGRTLD 390 Trichoplax a...
jgi:OSTLU_93007 397 KPSVAPLRHPDVLYNLISEAFKwtVDSGAN-RLRSECFELIALAAS-------------DDETSVDEVKA---ALTEAVA 459 Ostreococcus...
XP_002431657    311 PPPIDLIRTPQFLELLVDSLFK--PGIKLNPEHKPKYIYLLAYAASVCDTPAKKig-sSRRQLNKEELKPTQQAIEKVHG 387 human body l...
XP_310712       315 PPPIDLIRNPQFLELLVDSLFK--VGVKINQEHKSKYIYLLGYAASVCEIPTKKgqpkGHRVLNKDELKATIIAIEKVHA 392 Anopheles ga...
Q29GI5          386 I-CNVG-QGTSELIAELQTLYNCIKYPVVGVGVIRWIENVVMEPSFFK-LSTDSCP-THLAVLDEVAAVHPTLQQQILFL 461 Drosophila p...
XP_011252244    386 I-CNIN-KGSTELIAELHTLYQCIRFPVVSVGIIRWVECTVTEPSYFK-LCTEHCP-VHLALLDEVVVCHSLLHTKILNL 461 Florida carp...
OWR53707        383 V-CSSS-ASSSELLAELPALYHCIRFPVVGMGVLVWVEGVVTEKSYFK-LCTEHCP-VHLALLDEVASCHPLLHHRLLKL 458 Danaus plexi...
EFA00603        385 I-CNTN-KGSSELMAELATLYQCLRYPVVSVGIIRWVECTVTEASYFK-LSTEHTP-IHLALLDEVVTCHPLLHNQVLDL 460 red flour be...
XP_001944110    384 I-CNLN-KSSTELIAEVATIYHCIRYPAVAVGLICWVESTVTEPSFFK-LCTEHTP-THLALLDEVVTCHPQLHNIILKL 459 pea aphid
EFX85644        391 V-CTTA-KGSTELIAELGTLYQYIRFPVVSMGVFRWVEATVLEPSYFK-LSTEHTP-VHLALLDEVAAVNPLLHSNILDL 466 common water...
Q922L6          397 LcCNEN-KGASELVAELSTLYQCIRFPVVAMGVLKWVDWTVSEPRYFQ-LQTDHTP-VHLALLDEISTCHQLLHPQVLQL 473 house mouse
EDV25448        391 IiSHADcRSSNYLLSEIGNLYQYIRYPVVGRGLINWVDCIVSSSSFFN-YMGDSTAlIYLAILDEICTHHPLQHPTTFNL 469 Trichoplax a...
jgi:OSTLU_93007 460 IvENAK-RGEMPEQTSVDKVFA---IPCATAGIIAAARSALTNEMYHRvVQVGNANsVFVHVLGEVAKKHIGLQGVVLEA 535 Ostreococcus...
XP_002431657    388 I-CNTA-KGSGELIAELGSLYQCIKCPVVAVGIVRWVEFTVTEPSYFK-LSTEHTP-IHLALLDEVVTCHPLLHTKVLTL 463 human body l...
XP_310712       393 I-CNVS-RGSSELIADISTLYSCIRFPVVGVGVIRWVENTVTEPSYFK-LCTESCP-LHLALLDEVACVHASLHDQILRL 468 Anopheles ga...
Q29GI5          462 LIRLFE----SKQDELEILVQLEMKKMILDRMVNLLTRGCVVPVLRYVKQCCAIEDTDVSLIRYFVTEVLETITHPYSPE 537 Drosophila p...
XP_011252244    462 LVHLFE----SKQDELEILVQLEMKKMLIDRMVNLLSRGCVVPVVYYIKQCWQRGDTDVSLIRYFVTEVLEAIAPPYTAE 537 Florida carp...
OWR53707        459 LVQLFE----SPQDELEILVQLELRKMLLDRMVNLLSRGCVVPVLQYIKACWQRDDTDISLIRYFITEVLDAIAPPYTPE 534 Danaus plexi...
EFA00603        461 LIRLFE----SKQDELEILVQLEMRKMVLDRMVNLLCAGCVVPVVKYIKQCWQKGDTDISLIRYFVTEVLETIGPPYSSE 536 red flour be...
XP_001944110    460 FVSLFE----SKQDELEILVHLEMKKMLLDRMVNLLCCGCVVPVIKYIEQCWHRGDTDISLIRYFVTEALEAVSPPYSVE 535 pea aphid
EFX85644        467 LVRLFE----SRQDELEILVQLEMRKMLLDRMVNLLTRGYVVPIVKYIKQCWQRGDTDISLIRYFVTEVLESIAPPYTSE 542 common water...
Q922L6          474 LVKLFE----TEHSQLDVMEQLELKKTLLDRMVHLLSRGYVLPVVSYIRKCLEKLDTDISLIRYFVTEVLDVIAPPYTSD 549 house mouse
EDV25448        470 LIKFLE----YEYNNGDIMLILRFKRHIIECMVHLVSRGYVVPVLNYIRKCLDTNSMDNSLIRNFVSGVLDIISPPYTPI 545 Trichoplax a...
jgi:OSTLU_93007 536 LNAIIQscgsSHGAELAI--------SLLDLGCELVAAGHVMPTITAAANSWRR-TLDPSQIRYFANEVLEIAGPPYSRD 606 Ostreococcus...
XP_002431657    464 LIELFE----SKQDELEILVQLEMRKMLLDRMVNLLSRGCVVPVVKYVKHCWTRGDTDISLIRYFVTEVLEAVAPPYTLE 539 human body l...
XP_310712       469 LVRLFE----SKQDELEILVQLELKKMLLDRMVNLLARGCVVPVVKYISQCCTRGDTDISLIRYFVTEVLETVTHPYSSE 544 Anopheles ga...
Q29GI5          538 FVQLFLPMVENEEITGTMRGEGDNDPVSEFIVHCKAHY 575 Drosophila pseudoobscura
XP_011252244    538 FVQLFLPMVEDEEITGTMRGENENDLVSEFIVHCKTHC 575 Florida carpenter ant
OWR53707        535 FVQLVLPMVENEDITGTMRAEGEKDPVSEFRVHCKAHV 572 Danaus plexippus plexippus
EFA00603        537 FVHLFMPMVENDEITGTMRGDGENDPVSEFIVYCKANY 574 red flour beetle
XP_001944110    536 FVDLFLPIVENEEITGTMRCDGENDPVSEFIVHCKGmt 573 pea aphid
EFX85644        543 FVQLFLPMVENEEITGTMRGDGDGDLVSDFIVYCKANY 580 common water flea
Q922L6          550 FVQLFLPILENDSIAGTIKAEGEHDPVTEFIAHCKSNF 587 house mouse
EDV25448        546 FIELFLPLLKSDVCISLRQSQNKDDPAVNFIDYCETyk 583 Trichoplax adhaerens
jgi:OSTLU_93007 607 FAVVMIRLLDSANSRKRM-----SKTVDDFVEDVRVNR 639 Ostreococcus lucimarinus CCE9901
XP_002431657    540 FVQLFLPMVENEEITGSMRGDGENDPVSEFIVHCKAHY 577 human body louse
XP_310712       545 FVQLFLPMVENEEITGSMRGEGDNDPVSEFIVHCKAHY 582 Anopheles gambiae str. PEST
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap