2A1S


Conserved Protein Domain Family
CAF1

?
pfam04857: CAF1 
Click on image for an interactive view with Cn3D
CAF1 family ribonuclease
The major pathways of mRNA turnover in eukaryotes initiate with shortening of the polyA tail. CAF1 encodes a critical component of the major cytoplasmic deadenylase in yeast. Both Caf1p is required for normal mRNA deadenylation in vivo and localizes to the cytoplasm. Caf1p copurifies with a Ccr4p-dependent polyA-specific exonuclease activity. Some members of this family include and inserted RNA binding domain pfam01424. This family of proteins is related to other exonucleases pfam00929 (Bateman A pers. obs.). The crystal structure of Saccharomyces cerevisiae Pop2 has been resolved at 2.3 Angstrom resolution.
Statistics
?
PSSM-Id: 398496
Aligned: 142 rows
Threshold Bit Score: 86.321
Threshold Setting Gi: 154697868
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2A1S_C         3 IIRSNFKSNLHKVYQAIEEADFFAIDGEFSGIsdgpsvSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFkydYTD-S 81   human
XP_002129875   8 VTKGNLEPLWSKIVKDVKNSIFIALDTEMSGLg-----PQAQLMKSDLEQRYQGISAAASSRSIISLGLACF---EPY-S 78   vase tunicate
XP_023191906  12 VHSNNFKELWPAMVVAIKTSSFIAIDTELSGLg-----NRKSLLAESIEDRYKAICHAARSRSILSLGIACY---KKL-D 82   southern platy...
XP_011484875  12 VHSGNFKELWPALVVAIKTSSFIALDTELSGLg-----NRKSLLAESIEDRYKAICHAARSRSILSLGFACFkklDHKsP 86   Japanese medaka
XP_003456234  12 VQNENFKELWPAMVVAIKTASFVALDTELSGLg-----NRKSLLAESIEDRYKAICHAARSRSILSLGIACY---KKL-D 82   Nile tilapia
EEN59941       7 VTKDNFKELWPTILVALKTATFVALDLELSGLg-----NRRNLNTPSVDDRYKSLAGVARSRAVLSMGLSCF---KLN-N 77   Florida lancelet
EDO45139      12 VHAENLEAIWTVLVESIHTSSLIALDTELSGLg-----NRKKLIAKSVEDRFKFMADVVKSRSILTLGISCF---IEQ-E 82   starlet sea an...
XP_015789068  12 VNSTNIIACWPHLMKAIEQSHFLAIDLELSGLg-----DKKKLILKDIEERYKAIGEVAKTRSILSVGLSFFrynRKL-I 85   two-spotted sp...
EDQ88348     543 VHRDNATKLLPRLMLALSRASFVALDLEMTGLg-----DRRQARAKDMNTKYGVYCQAARSRALLSMGLAVFsesHPQaE 617  Monosiga brevi...
CAG10908      12 VQSDNFKELWPALILAIKSSSFVALDTELSGLg-----NRKSLLAESIEDRYKAICHAARSRSILSLGIACY---KKL-E 82   spotted green ...
2A1S_C        82 k------------YIT-----KSFNFYVFPKpfnrsspdVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQE-----EE 139  human
XP_002129875  79 gke-------plaYNV-----TVYNIIVLCS--------DPFTIDPGAVSFLVNHGFNFNKQFCNGISYYKGNdr-pkEK 137  vase tunicate
XP_023191906  83 qkp-------pdsYLV-----QVYNLTLLCS--------EEYIIEPQSVQFLVQHGFDFNKQYGSGIPYCKGNnkggsDD 142  southern platy...
XP_011484875  87 d-----------sYLV-----QVYNLTLLCS--------EEYIIEPQSVQFLVQHGFDFNKQYSHGISYCKGNnkggsDD 142  Japanese medaka
XP_003456234  83 qkp-------adsYLV-----QVYNLILLCS--------EEYIIEPQSVHFLVQHGFDFNKQYGHGIPYCKGNnkggaDD 142  Nile tilapia
EEN59941      78 iad-------edgSLVlpfttQTFNLTLLCS--------EEYVVEPISLKFLVDHGFDFNMQYSQGAPYHRGAdk--nGE 140  Florida lancelet
EDO45139      83 vgimt---qfpdnS-------KTFNLSVLCS--------EDFVVEPGSLQFLVQHGFDFNKQYSKGMPYTRGNdktchDY 144  starlet sea an...
XP_015789068  86 ngsdqtdwrnkdeFCDwnfkvINFELLTLCN--------EESVLEDESRSFLVSHGFDFDAQTSIGLQYLRADqelnpDV 157  two-spotted sp...
EDQ88348     618 ssen-----avvhYQV-----QVFELLLSSL--------REYVVEPLSLQFLLRHGFDFNRQVRDGLTYTPGAgateaEA 679  Monosiga brevi...
CAG10908      83 qka-------adtYLV-----QVYNLTLLCS--------EEYVIEPQSVQFLVQHGFDFNRQYSVGIPYFKGNdkggsDD 142  spotted green ...
2A1S_C       140 RQL-----------------------------REQYdekrsqangagalsyvspntskcpvtipedqkkfidqvvekied 190  human
XP_002129875 138 DKL----------------------------------------------------------------------------- 140  vase tunicate
XP_023191906 143 RGV----------------------------------------------------------------------------- 145  southern platy...
XP_011484875 143 RGI----------------------------------------------------------------------------- 145  Japanese medaka
XP_003456234 143 RGV----------------------------------------------------------------------------- 145  Nile tilapia
EEN59941     141 VPQ----------------------------------------------------------------------------- 143  Florida lancelet
EDO45139     145 STP----------------------------------------------------------------------------- 147  starlet sea an...
XP_015789068 158 PS------------------------------------------------------------------------------ 159  two-spotted sp...
EDQ88348     680 PPAskrakagsasgsgpgpgprsdsaasraliRKEV-------------------------------------------- 715  Monosiga brevi...
CAG10908     143 RGV----------------------------------------------------------------------------- 145  spotted green ...
2A1S_C       191 llqseenknldlepctgfqrkliyqtlswkypkgihvetletekkeryiviskvdeeerkrreqqkhakeqeelndavGF 270  human
XP_002129875 141 ------------------------------------------------------------------------------TM 142  vase tunicate
XP_023191906 146 ------------------------------------------------------------------------------HI 147  southern platy...
XP_011484875 146 ------------------------------------------------------------------------------HI 147  Japanese medaka
XP_003456234 146 ------------------------------------------------------------------------------HI 147  Nile tilapia
EEN59941     144 ------------------------------------------------------------------------------SV 145  Florida lancelet
EDO45139     148 ------------------------------------------------------------------------------SV 149  starlet sea an...
XP_015789068 160 -------------------------------------------------------------------------------I 160  two-spotted sp...
EDQ88348     716 -------------------------------------------------------------------------------P 716  Monosiga brevi...
CAG10908     146 ------------------------------------------------------------------------------HI 147  spotted green ...
2A1S_C       271 SRVIHAIANS-GKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFP-R-LLDTKLMAStqPfkdiiNNTSLAEL- 346  human
XP_002129875 143 RSLFAEIIKL-RKPLVLHNGLVDLVFLYNSLYAELPGTLNSFMADVCEIFPaG-IYDCKYIA---EfcdrlTASFLLYA- 216  vase tunicate
XP_023191906 148 RTLFTELLRA-RKALVLHNGLIDMAFLYQSFYAHLPERLATFTADLSEMFPaG-IYDTKYVT---EfelrlTASYLEYA- 221  southern platy...
XP_011484875 148 RALFTELL-RaRKPLVLHNGLIDMAFLYQSFYAHLPERLATFTADLSDMFPaG-IYDTKYITEfel---rlTASYLEYA- 221  Japanese medaka
XP_003456234 148 RALFTELLRA-RKPLVLHNGLIDMAFLYQSFYAHLPERLATFTADLSEMFPaG-IYDTKYVT---EfelrlSASYLEYA- 221  Nile tilapia
EEN59941     146 RQLFSELVCS-RVPLILHNGLVDLVFLYQSFYTELPPTLGSFLADLSEMFPaG-IFDTKCIT---DfhirmPASYLEYV- 219  Florida lancelet
EDO45139     150 RNLFSQIVIS-NKPIALHNGFFDLLYLYQSFYAELPSKLEVFLSDVYEMFTgG-VIDTKYVA---EyhmrePASYLGYI- 223  starlet sea an...
XP_015789068 161 RNLFHQLVNK-KVPLVLHNGLLDLIFIYHNFLANLPPKLPTFVADLDKLFPkG-IFDTKYVA---EhnfksKGSYLEYL- 234  two-spotted sp...
EDQ88348     717 RRVFEALIQS-TAPIVTHNGLLDLCFLYQHLWADLPATLDVFVADCSQLF--GrVIDTKYVA---EyearePASFLEYLf 790  Monosiga brevi...
CAG10908     148 RALFTELLRA-KKPLVLHNGLIDMVFLYQSFYAHLPERLATFTADLSQMFPaG-IYDTKYAC---EfelrlAASYLEYA- 221  spotted green ...
2A1S_C       347 ---EKRLKETPFNP----PKVESAEG------------------------------------------------------ 365  human
XP_002129875 217 ---FKKTQWKNEALaaagKICLKVHFkmesewtvtvplnvggnkaishknikgveicekyaaygwcrngilckkvhdi-- 291  vase tunicate
XP_023191906 222 ---YKKCKLENSRSvtsgSAGPHVHLefcqyagdlstyvdyrqcpavtsieghtdvcqrfsafgwcpngtkcplshdtdl 298  southern platy...
XP_011484875 222 ---YKKCKLDNSRGvssgAPGPHLHIgfcqyaghmstyvdyrecpavasseeqtevcqrfsafgwcpngtkcplshdtdl 298  Japanese medaka
XP_003456234 222 ---YKKCKLDNGRSvgsgTTGPHVHIefcqyaghmstyvdyrecpavasvdeqtdicqhfsafgwcpngtkcplshdtdr 298  Nile tilapia
EEN59941     220 ---FRRSQRENAVHqtkqQPHVTLTFppypphmvcveyrdcclpdnllnttqsttvipyceqyaahgtcpkgvlcpqshd 296  Florida lancelet
EDO45139     224 ---FRKCQRHNLSCkvagARYTEILMvedrilkpwieelccyasvkshdsdgqtlqvcdlyashgfchkgftcplshdmd 300  starlet sea an...
XP_015789068 235 ---FYQRQRRNLERrvanKPFISISFgsddsirdfvversmksiilgdkpeglkicddyrqhgwckkgascqkshd---- 307  two-spotted sp...
EDQ88348     791 rtaFRRVQRGVGMAlqqpAYTMHLPAsyrgeyampalqsrwplteasrlcrhyerfghcnrgeac--------------- 855  Monosiga brevi...
CAG10908     222 ---YKKCKLETSRSaalgQDTPHVHIefcqyaahmsnyvdyrvcpeaspaagetalcrqfsafgwcpnggqcplshdtdl 298  spotted green ...
2A1S_C           --------------------------------------------------------------------------------      human
XP_002129875     --------------------------------------------------------------------------------      vase tunicate
XP_023191906 299 iilqdekgkdekrkkrkrrrekkgssdiaed-------------------------csafdgtpkdkipnmeadkeeaag 353  southern platy...
XP_011484875 299 iilqdekckddkrkkrkrqrekkrg-------------------------------------ggataegsavfdgaplnk 341  Japanese medaka
XP_003456234 299 iilqdeknkedkwkkrkrqrekkrsegegssifdgapenkipnmevdpedppgdqrgtvaemcpdglpamdsdgntpqse 378  Nile tilapia
EEN59941     297 pdiiidqedwvk---------------------------------------------------------------arkkr 313  Florida lancelet
EDO45139     301 lildrdq------------------------------------------------------------------------r 308  starlet sea an...
XP_015789068     --------------------------------------------------------------------------------      two-spotted sp...
EDQ88348         --------------------------------------------------------------------------------      Monosiga brevi...
CAG10908     299 viqqdeknlrerkrkr------------------------------------------------------krqrekktdg 324  spotted green ...
2A1S_C       366 ------------------------------------------------------------FPSYDTASe----------- 374  human
XP_002129875 292 ---------dtivqfhktskqkrkrkrtksssdtkdvqtlmeqdeikpteenanpikravFDNSTNTQ------------ 350  vase tunicate
XP_023191906 354 dqmeaheksrtdgnsrmddgwdtktddeeengvgeetnpgdsaasagegtgvrsaeskaeAKKKADAG------------ 421  southern platy...
XP_011484875 342 ipnmevdpegdkqdtttetrrddlphgeseakpdeeqslsaekdggaelqncpttgtaeeSKPEEGSEeklsdrsvkaqk 421  Japanese medaka
XP_003456234 379 gksletdskgnsvcdenvtiasiddsqntknntndgksgvgsgtgagrektnnrsagietQKKNADAG------------ 446  Nile tilapia
EEN59941     314 rrdrkkrkgnkseegeqdkaenpvsmetddgrdvssvedtdsvscdsqthtdqsdggidnVVAKTRVG------------ 381  Florida lancelet
EDO45139     309 iehkkskrkrkrkaagnnetleksssevsrlahdivdtdrlpsnqhttdtagstklptekPSSASTSG------------ 376  starlet sea an...
XP_015789068 308 -----------idfilddedfykepsktrkrilakmnlinspkndvemgevgdsieikehINGQVKSG------------ 364  two-spotted sp...
EDQ88348     856 ---------------------pnlhdldlvldvqeartrkprqtpsgdqpssvpltvapsGAAGNTVH------------ 902  Monosiga brevi...
CAG10908     325 dkaafdsapqnkvahlmederrrpetlpetdgggrekegesngsedksslvtpddggaaaPSKTVNTG------------ 392  spotted green ...
2A1S_C       375 -----qLHEAGYDAYITGLCF 390  human
XP_002129875 351 ------GHRSSLDAFMTGYIF 365  vase tunicate
XP_023191906 422 ------SHRAGFDAHMTGYIF 436  southern platyfish
XP_011484875 422 kkadtgTHRAGFDAYMTAYIF 442  Japanese medaka
XP_003456234 447 ------THRAGFDAFMTGYIF 461  Nile tilapia
EEN59941     382 ------CHRAGFDAFMTGFAM 396  Florida lancelet
EDO45139     377 ------GHRAGIDAFMTGYCL 391  starlet sea anemone
XP_015789068 365 ------IHRSGYDAFMTGYCF 379  two-spotted spider mite
EDQ88348     903 ------GHRAGFDAFMTGFYF 917  Monosiga brevicollis MX1
CAG10908     393 ------THRAGFDAFMTGYVF 407  spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap