Conserved Protein Domain Family
SNF5

?
pfam04855: SNF5 
SNF5 / SMARCB1 / INI1
SNF5 is a component of the yeast SWI/SNF complex, which is an ATP-dependent nucleosome-remodelling complex that regulates the transcription of a subset of yeast genes. SNF5 is a key component of all SWI/SNF-class complexes characterized so far. This family consists of the conserved region of SNF5, including a direct repeat motif. SNF5 is essential for the assembly promoter targeting and chromatin remodelling activity of the SWI-SNF complex. SNF5 is also known as SMARCB1, for SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin, subfamily b, member 1, and also INI1 for integrase interactor 1. Loss-of function mutations in SNF5 are thought to contribute to oncogenesis in malignant rhabdoid tumors (MRTs).
Statistics
?
PSSM-Id: 398495
Aligned: 95 rows
Threshold Bit Score: 177.348
Threshold Setting Gi: 353237211
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCA69189      881 SKQEMLVPVRIDVDIgDgYNRLRDTFVWNANDPYVTPTVFAQTLCDDFAIGfglgqasESArRKFIDQVVSSIHEQITDY 960  Serendipita i...
CCA69450      192 SLPVVLIPIRIELDT-D-RYRIRDCFMWNLN------GIFAQIFCYDLGLE-----------AYYMEQVSNQISAQLEEH 252  Serendipita i...
XP_007845513  280 RRPSALVPIRVEFDT-D-THRIRDCFVWNLYEEAIKPEAFARIFCNDLDLP-------VDT---WADTVANQIKAQLEDC 347  Moniliophthor...
EGN98539      237 RKPTALVPIRVEFET-D-THRIRDCFVWNMNETLIKPEAFARTFCSDLDLP-------AIP---WVDTVTNQIRAQLEEH 304  Serpula lacry...
EED80298      172 RRPTSLVPIRVEFET-D-TLRIRDCFVWNLHEDLIKPESFARAFCVDLDLP-------VNP---WAETVANQIRAQLEEH 239  Postia placen...
EKM51678      278 RKPVALIPIRVEFET-D-AHRIRDCFVWNLHEDLIPPEVFARTFVQDLDLP-------EHP---WVELVANQIRAQLEEH 345  Phanerochaete...
EMD39783      283 KKSTALVPIRVEFET-D-THRIRDCFVWNLHENLIKPEAFARTFCADLDLP-------VNP---WAELVANQIRAQLEEH 350  Gelatoporia s...
EPT02261      248 RKPTALVPIRVEFET-D-THRIRDCFVWNVHEDLIKPESFARTFCADLDLP-------ANP---WADLVAAQIRAQLEEH 315  Fomitopsis pi...
XP_001875852  160 QRRSSLVPIRIEFET-D-TYRVRDCFVWNLNETIIKPETFARILCNDLDLS-------PNQ---WADTVANQIRAQLEEH 227  Laccaria bico...
XP_007329948  275 SKRTSLIPIRVEFET-D-THRIRDCFVWNVNEELIKPETFARIFCYDLDLP-------LT----FVETVAAQIRAQIEEY 341  Agaricus bisp...
CCA69189      961 knhrveieanttkpstaavppstsgtplpihskpistiggltvnglgreasrsrsatplpgereksekpisaikkrasfv 1040 Serendipita i...
CCA69450      253 gataaldlpvnte------------------------------------------------------------------- 265  Serendipita i...
XP_007845513  348 envvrmelgmdga------------------------------------------------------------------- 360  Moniliophthor...
EGN98539      305 egvasmdlrgam-------------------------------------------------------------------- 316  Serpula lacry...
EED80298      240 egvaavdfgvpdp------------------------------------------------------------------- 252  Postia placen...
EKM51678      346 egvgsmdfdva--------------------------------------------------------------------- 356  Phanerochaete...
EMD39783      351 egvasldlgadyhm------------------------------------------------------------------ 364  Gelatoporia s...
EPT02261      316 egiaaldlgtea-------------------------------------------------------------------- 327  Fomitopsis pi...
XP_001875852  228 egvasmelgldga------------------------------------------------------------------- 240  Laccaria bico...
XP_007329948  342 egvasmelgqdga------------------------------------------------------------------- 354  Agaricus bisp...
CCA69189     1041 dsgigkkrhrpandgpsgvgkfeeedevqwwerwrkrmraldgsavrksskakvagvgkagrsskpalrvggrkskasla 1120 Serendipita i...
CCA69450          --------------------------------------------------------------------------------      Serendipita i...
XP_007845513      --------------------------------------------------------------------------------      Moniliophthor...
EGN98539          --------------------------------------------------------------------------------      Serpula lacry...
EED80298          --------------------------------------------------------------------------------      Postia placen...
EKM51678          --------------------------------------------------------------------------------      Phanerochaete...
EMD39783          --------------------------------------------------------------------------------      Gelatoporia s...
EPT02261          --------------------------------------------------------------------------------      Fomitopsis pi...
XP_001875852      --------------------------------------------------------------------------------      Laccaria bico...
XP_007329948      --------------------------------------------------------------------------------      Agaricus bisp...
CCA69189     1121 ngsssksvkieaeevdlkvpivsepdeyqrelifvddeekepadninEDLRILIKLDIAFGVRRLEDQFEWDISDKRnSP 1200 Serendipita i...
CCA69450      266 ----------------------------------regeilheddagpGDCRVVLQIDVQIGTKHMLDHIEWDLRSPL-TP 310  Serendipita i...
XP_007845513  361 -----------------------------------vdferqgtvdeiPECRVILSIDVQIATHHLLDHIEWDLLSPL-TP 404  Moniliophthor...
EGN98539      317 -----------------------------------didmddengeeiPECRVVLSIDVQIATHHLLDHIEWDLLSAL-TP 360  Serpula lacry...
EED80298      253 -----------------------------------emeeklrageemGECRVILSIDVQIATYHLCDTIEWDLLSSL-TP 296  Postia placen...
EKM51678      357 -------------------------------------npfgpgedevPECRVILSIDVQIATYHLLDHIEWDLLSPL-TP 398  Phanerochaete...
EMD39783      365 ---------------------------------dvdgdsdntsveeiPECRVILSIDVQIAGYHLVDHIEWDLLSPL-TP 410  Gelatoporia s...
EPT02261      328 -----------------------------------diedetseggevPECRVILSIDVQIANHHLSDHIEWDLLSPL-TP 371  Fomitopsis pi...
XP_001875852  241 ----------------------------------vdidappthgeeiAECRVILSIDVQIANHHLMDHIEWDLLSPL-TP 285  Laccaria bico...
XP_007329948  355 ----------------------------------pdfdnngqssdeiPECRVILSIDVQIANHHLMDHIEWDLLSSL-TP 399  Agaricus bisp...
CCA69189     1201 EQFAEVYCVDLGLSGEFKTAIAHSIREQVQVYEKSLYlvghpmdgttiqdedlrla------------------------ 1256 Serendipita i...
CCA69450      311 EEYTSVFCADVGLSSEAVPMIAHAIHEELLKHKKDVIewgvlegggewkshaaglgnawgr------------------k 372  Serendipita i...
XP_007845513  405 EAFATTLCADLGLSGEAIPLVAHAIHEELIKHKKDVVdwgiissaaaatesgltkdktgl-------------------- 464  Moniliophthor...
EGN98539      361 EAFSQQLCSELGLTGEAIPLIAHAIHEELVKHKRDAIewgviggdkdpaeepapdkprdksglsllkdktglglgwgrtp 440  Serpula lacry...
EED80298      297 EAFASKLCSELGLSGEAVPLVAHAMHEEIVKHKRDALewgviggdareadderprdksglsllkdktg---lglgwgrap 373  Postia placen...
EKM51678      399 EQFASQLCADLGLAGEAVPLVAHAIHEELIKHKRDAIewgivgvdphpsahddpdrprdrsglsllkdktglglgwgrtp 478  Phanerochaete...
EMD39783      411 EAFATTLCAELGLAGEAVPLIAHAVHEELVKHKRDAVewgvigvetreadepaadrprdksglsllkdktglglgwgrap 490  Gelatoporia s...
EPT02261      372 EQFAGTLCAELGLAGEAVPLIAHAVHEELLKHKRDAWewgvlgieqqhaadedrprdrsgasllkdktg--lglawgrap 449  Fomitopsis pi...
XP_001875852  286 EAFSQKLCTELGLSGEAVPLIAHAVHEELIKHKKDAIewgviggdrepaddgsgvrdrsgagmlkdktg--lglgwgrap 363  Laccaria bico...
XP_007329948  400 EAFAQNLCWGLGLSGEAVPLVAHAVHEELMKHKKDAIewgviggereigddagardrsgfglvkdktg---lglgwgrap 476  Agaricus bisp...
CCA69189     1257 ----flpslascirpmdqiaayTPQLGFFNEVDLEKT 1289 Serendipita indica DSM 11827
CCA69450      373 gkgpkrmkgiwrdwaeivsgdySPRIEELTAEELEKK 409  Serendipita indica DSM 11827
XP_007845513  465 grvrgpkplksvwrdwaeaeefRTRFEEMSQEEVERR 501  Moniliophthora roreri MCA 2997
EGN98539      441 kegrgpkllksiwrdwpeaeefRTKFEILSAEEVERR 477  Serpula lacrymans var. lacrymans S7.3
EED80298      374 kdgrgpkplrsvwrdwaeaeefTTRFEVLTAEEVERR 410  Postia placenta Mad-698-R
EKM51678      479 kdgrgpkslrsvwrdwaeteefKTRFEVLTPEEVERR 515  Phanerochaete carnosa HHB-10118-sp
EMD39783      491 kdgrgpkslksvwrdwaeaeefRTRFEVLTQEEVERR 527  Gelatoporia subvermispora B
EPT02261      450 kdgrgpkalrsvwrdwqeaeefRTRFEVLTAEEVERR 486  Fomitopsis pinicola FP-58527 SS1
XP_001875852  364 rdgrgpktlksvwrdwaeaeefRTTFEELTAEEVERR 400  Laccaria bicolor S238N-H82
XP_007329948  477 kdgrgpktlrsvwrdwqeadefRTKFEELTAEEVERR 513  Agaricus bisporus var. burnettii JB137-S8
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap