Conserved Protein Domain Family
HAP1_N

?
pfam04849: HAP1_N 
HAP1 N-terminal conserved region
This family represents an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologs. HAP1 binds to huntingtin in a polyglutamine repeat-length-dependent manner. However, its possible role in the pathogenesis of Huntington's disease is unclear. This family also includes a similar N-terminal conserved region from hypothetical protein products of ALS2CR3 genes found in the human juvenile amyotrophic lateral sclerosis critical region 2q33-2q34.
Statistics
?
PSSM-Id: 398490
Aligned: 25 rows
Threshold Bit Score: 327.737
Threshold Setting Gi: 23821675
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003642869         123 QLPRYTLRADTVF---GYDHEDW-LHAPP---ASQPTAPLTPQQIEETLWyfLLCAErAVRItK-TYHDIDAVTNLLDE- 193  chicken
O35668                82 FQGPYGPRATGLGt--GKAEGIWkTPAAYigrRPGVSGPERAAFIRELQE--ALCPN-PPPTkKiTEDDVKVMLYLLEE- 155  house ...
P54257               109 FQGPFGSRATGRGt--GKAAGIWkTPAAYvgrRPGVSGPERAAFIRELEE--ALCPNlPPPVkKiTQEDVKVMLYLLEEl 184  human
XP_013836418         110 FRGPFGSQASGLGt--GKAAGIWkTPAACisrRPEVSGPERTAFIRELEE--ALCPDqPLPVkKiTQEDVKVMMNLLEE- 184  pig
EEN54474              22 EIPRYKLRADTVF---GYENKDW-LESPAl--PPDTPVDLSPEQAEETLKyfALCSDrVAQMtK-TYNDIEAVTRLLEE- 93   Florid...
EFX86135              23 KIPLYTLRGDSAAaltGYQSQSWyIPPPSqriPAPTEDLLTPEQTKETLNyfLLCGErVSQMtK-TYNDVEAVTRLLEE- 100  common...
WGS:AAQB:GK15273-PA   91 QIPKYKVRSDFLTdfsGYANEDWfVPAPAlpiPPE-GLGLTKDQTRECLNyfLLCGNrVSQMtR-AYDDIEAVTRLLEE- 167  Drosop...
EFA09509             117 QIPKYKLRADTLTkfgGYENQDWfIPSPAl-qIDEADLKLSPDQIRETLNyfLLCSNrVSQMtK-TYDDIEAVTRLLEE- 193  red fl...
XP_029347254          54 TIPQYKLRADTLTqftGYENKDWyIPSPAsneDEVDTASLSKEYIRETLNyfLLCSNrVSQMtK-TYNDIEAVTQLLAE- 131  pea aphid
XP_014908790          92 QLPVYRLRADTVY---GYDNDDW-LHTPLv--APDARLDLTTEQIEETLKyfLMCADrVGQMtK-TYNDIDAVTRLLEE- 163  sailfi...
XP_003642869         194 ---------------KERDLELAARIGQSLLKQNRSLTERNELLEEQLELAKEEIAQLRHEVSMRDDLLHFYTTN----- 253  chicken
O35668               156 ---------------KERDLNTAARIGQSLVKQNSVLMEENNKLETMLGSAREEILHLRKQVNLRDDLLQLYSDSdddd- 219  house ...
P54257               185 lppvwesvtygmvlqRERDLNTAARIGQSLVKQNSVLMEENSKLEALLGSAKEEILYLRHQVNLRDELLQLYSDSdeede 264  human
XP_013836418         185 ---------------RERDLNTAARIGRSLVKQNSVLTEENSKLEAMLGSAREEILHLRHQVSLRDDLLQLYSDS----- 244  pig
EEN54474              94 ---------------KERDLELAAKIGQSLLERNRLLSQKNDYLEEQLQIVSERNNQLQHELQLKEDLLQIYTQE----- 153  Florid...
EFX86135             101 ---------------KEKDLELAARIGQGLLTRNKALEERLIAVEGELHSAHDTVTQLRHDLLLKGELLQIYSND----- 160  common...
WGS:AAQB:GK15273-PA  168 ---------------KEKDLELTVQIGQDLLKQNNALELRVSHLEAELKESNDDRSQLVHELHKKNELISVLTDD----- 227  Drosop...
EFA09509             194 ---------------KEKDLELTARIGKELLQANSKLENTIASLETDLKSALEKITQLSHEVQKKTELIQILTND----- 253  red fl...
XP_029347254         132 ---------------KEKDLELTARIGKELLTGNQTLEARVGLLETELKTVNERYTQASYELQKKNDLIKILSND----- 191  pea aphid
XP_014908790         164 ---------------KERDLELAAKIGQSLLKKNRTLTEQNDYLEEQVGQITEEVAQLHHELNLKDELLQFYTNA----- 223  sailfi...
XP_003642869         254 ---TEEN----EPTSAPITP-LRRNESSl------------------S-LQQYFQYDALQQKLRCLEEENQKLRLEATTI 306  chicken
O35668               220 deeDEED----EEEGEEEEReGQRDQDQqhdhpyga---pkphpkaeT-AHRCPQLETLQQKLRLLEEENDHLREEASHL 291  house ...
P54257               265 deeEEEE----EKEAEEEQEeEEAEEDLqcahpcdap-klisqeallH-QHHCPQLEALQEKLRLLEEENHQLREEASQL 338  human
XP_013836418         245 ---DEEE----EEEEEGEEE-EEEEEEEeeeedgeeeeeqrtplaesE-LHCCPQLEALQEQLRLLEEENEQLREEASQL 315  pig
EEN54474             154 ---ESLS----ETDSSCTSPaTRHDRTLl------------------L-PSGLVNIDALHKKIQTLEEENLHIRSEAAKL 207  Florid...
EFX86135             161 ---FDDS----SPEGVRA-----------------------------------FTTDLLQRKVKGLEDDNRKLRAEASQL 198  common...
WGS:AAQB:GK15273-PA  228 ---ADDG----TDADTPTMS-------------------------------KSVTLDLLQKKVNSLLDENKTLKHEATQL 269  Drosop...
EFA09509             254 ---MDES----IFENGTSGR---------------------------------INLELMQKRMAGLEEENKALKSEYNRL 293  red fl...
XP_029347254         192 ---ADETgyeaNDDAVENEK------------------------------YYGVSVGYLQSRLKNLEDENRSLRGEANRL 238  pea aphid
XP_014908790         224 ---AEEC----EDESAASPT---SKKSKa------------------EtASGVFLSDTLQRKLKELEEENLSLRSEASHL 275  sailfi...
XP_003642869         307 vtetSRYEDQEQQLMIDCVEQFSAASQQVVCLSEELARKAEDTARQQEEISQLLAQVVELQQKCRTYGTEVEELQQHLAA 386  chicken
O35668               292 ----DNLEDEEQMLILECVEQFSEASQQMAELSEVLVLRLEGYERQQKEITQLQAEITKLQQRCQSYGAQTEKLQQMLAS 367  house ...
P54257               339 ----DTLEDEEQMLILECVEQFSEASQQMAELSEVLVLRLENYERQQQEVARLQAQVLKLQQRCRMYGAETEKLQKQLAS 414  human
XP_013836418         316 ----DDLEEEEQMLILDCVEQFSEASQQMAELSEVLALRMENFEQQQREVAQLRAQVVKLQQCCRSYGVETEKLQQQLAS 391  pig
EEN54474             208 ktetVDYEEQEAKLVSDCVKELKEANTQIKQLTEELVRKNEDNARFQEESTSYLAQTIDLNKKLKKSALENEELQQHLRV 287  Florid...
EFX86135             199 anesSETELREEQLLHQVVAQLAEANNHIKNLDEELANKYDEAGKHREEITSLLGQLVSQRHKIRELTLENEDLTMQLHV 278  common...
WGS:AAQB:GK15273-PA  270 ahqtDEVEEHERKLMADIGAQLNDANSQYDNLSLDLERQMEENRLQHEQIVNLTARLREAEMRLHQLTEDNEGHLSMLHI 349  Drosop...
EFA09509             294 ardtETVEAKEQMLLKDLTGQLTCANTSMGFLEDELDRQKEENRFQHEQILTLQSKLQDMEERLNKFMSENYELNGLLQI 373  red fl...
XP_029347254         239 ametDEVEAKEAQLMSDFASQLSVTRSDLSVIMEQADKHRDENVTLHNNCEFLRSKLSSVETSLKIKNDENEELMAMLML 318  pea aphid
XP_014908790         276 ksetETYEEKEQQLVSDCVKELRLSSLQISAIAEELARKTEDASRQQEEITHLLSQIVDLQKKAKSLAVENEELSQHLVA 355  sailfi...
XP_003642869         387 AKEVQqqlrTE-------LQDLQDKYVEcggmlqeAQEEVKSLRSR 425  chicken
O35668               368 EKGIH----SEslragsyMQDYGSRPRD-------RQEDGKSHRQR 402  house mouse
P54257               415 EKEIQmqlqEEsvwvgsqLQDLREKYMDcggmlieMQEEVKTLRQQ 460  human
XP_013836418         392 EKEIQmqlqDE-------LQDLREKYSEcggmlieAQDEVRTLRQQ 430  pig
EEN54474             288 AKETQqeltEE-------LRDLEEKYQEvmgmlheAQAEAKTMRKK 326  Florida lancelet
EFX86135             279 VRDCQtelvAE-------LSEYKDKYAEilellheTQEQVKEQNKR 317  common water flea
WGS:AAQB:GK15273-PA  350 TKETQnalaLE-------LVEFKQRYEEvlallhsAQDQLKQQRKR 388  Drosophila willistoni
EFA09509             374 TKDNQgslaIE-------LSEFKARYYEvesllrdTQEQLRKLRKK 412  red flour beetle
XP_029347254         319 ARDTQnelaSE-------IVEVKKQYEEvltmlheCQTELKGYRDK 357  pea aphid
XP_014908790         356 AKDAQrqltAE-------LQELEEKYSEciemlheAQEELKNLRNR 394  sailfin molly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap