Conserved Protein Domain Family
Popeye

?
pfam04831: Popeye 
Popeye protein conserved region
The function of Popeye proteins is not well understood. They are predominantly expressed in cardiac and skeletal muscle. This family represents a conserved region which includes three potential transmembrane domains.
Statistics
?
PSSM-Id: 398483
Aligned: 33 rows
Threshold Bit Score: 221.321
Threshold Setting Gi: 551548471
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003723894  22 SQHSIYQLGSFVLFNGFLVPPNVgiAQALWLRSTLVIGGFCHVLWSGPVLCWPDAFGWNMAALFLNLAHLLYLLYLVYPT 101 purple sea urchin
XP_008190054 131 AQQSLFQFSNICFLTAFIVPRSYk-LSVLSLRALLFLGFLISGLWASTDVCAVDALFWYGSLALINGIHTLKLCKKLMPP 209 pea aphid
XP_002590395   7 AQHVLFQLASICFLLALLLPQVIk-PHTWIFRGLLILGFIFMCLWGGIAVCITDVIGWYILFIVMNLVHVSYLAYVQREA 85  Florida lancelet
XP_027310575  39 ihhlVFHVANICFAVGLVIPTTLn-FHMIFLRGLLTIGCALFIIWATLYRCALDIMIWNSVFLVVNLLHFIYLVYKRRPI 117 mallard
XP_001952663  54 FNHPYFHFSHAIMFICYMLPFGSpcQLILLIRIGLAGATTIMALWARNVQCWVDSLLWNAASAAVNVVHILVLFYQLRPI 133 pea aphid
XP_002134557 102 PHHLYFQLGWAFLFLAFLAPHGP--FGSLWMRAMLLIGCIMMGMYGYLVECTPDVVLWSGLGIGVNFIYLIVVLCRLRPV 179 Drosophila pseu...
EEC05992      39 PNHLLFHLANASLLLSYLAPEGI--YGLLYLRFCIAVGSLFFAMWGCLVLCSVDTLVWNALFTLINLAHLCVLAYTFRPV 116 black-legged tick
EEC01444      53 TNHVYFHIANVFLLLSYVTPEGP--YGLLYLRAVIGAGSFLFALWATVVLCAFDTFLWNSLFTLINLVHGLVLIYALRPV 130 black-legged tick
XP_030346695  39 IHHLVFHVANICFAVGLVIPTTLn-FHMIFLRGLLTIGCALFIIWATLYRCALDIMIWNSVFLVVNLLHFIYLVYKRRPI 117 Kakapo
XP_002127439  22 PQNLTFHVSMALFLVSCVIPSTFk-HYVITNRVFLFLSVVMFMLWGGLYWCTWDVIWWGAVLIIQILAQLVFAIYKKRHV 100 vase tunicate
XP_003723894 102 HFEEEVEKVYETHFHPFNITKKEFKKILDc-DGEIYELDATGRYAAENKTRTDKQIAMLLTGRMIVSAGGQFLHYIHPTq 180 purple sea urchin
XP_008190054 210 ALSVELMELYLRVFKPLKVSQKHFRELTR--EAAIEELSPGECYAVEAVTACDQRLSILLRGRCGVTCEGTQLHNISSYq 287 pea aphid
XP_002590395  86 EFEKILEDVYAKIFQPLKVTRDTFANLVAa-RGKIFELKQGDVYAVEKRTTSEDRIAILISGTLRVSCEDHLLHYIYPNq 164 Florida lancelet
XP_027310575 118 KIEKELSSLYKRMFEPLHVPPELFQRLTGq-FCNIQTLKTGQAYAAEDKTSVDDRLSILLKGKMKVSYRGHFLHNIYPCa 196 mallard
XP_001952663 134 KFNDELELVYETLFYPLKVSRKQFSKIVSc-MKMIRPLKTLEIFAEEKVTRVDSLSLVLSGKLVISQNGNALHIVFPY-- 210 pea aphid
XP_002134557 180 RFEQEIEAVYMALFQPLHVTRHQFKKVLNc-MKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVVSQHQRALHIVFPH-- 256 Drosophila pseu...
EEC05992     117 RFKPDLEVIYKELFQPLKMTRHQFQKVADc-AMEALELDARGDYSFEKVNPTDSLSLVLSGRLLAYRNGCVLLLIGKL-- 193 black-legged tick
EEC01444     131 SLPGELRAVFEVLFQPLGVTRRQFHIIATrvEGT-QELCPGQNLAVEKVTQNDRLSLVLSGSLLASENSRPLQVVGKY-- 207 black-legged tick
XP_030346695 118 KIEKELSSLYKRMFEPLHVPPELFQRLTGq-FCNIQTLKTGQAYAAEDKTSVDDRLSILLKGKMKVSYRGHFLHNIYPCa 196 Kakapo
XP_002127439 101 KFPTALEDLYIDVFQTFAVTRQEFKALVHq-NCKWVHIFPGDKYAVEGNTTVEARVSMLVSGTLRVTYRGMFLHDIKDKe 179 vase tunicate
XP_003723894 181 -FLDSPEWEASSDGTKSKFQVTITADIYCRYIQWRRRKLENFLRREPFLRSVFETTIGKDITKKLYGIDEP 250 purple sea urchin
XP_008190054 288 fIDSPEWMASALMHGETMFQVTITAAEDCVYLCWQLSKLNRIFKHRTQLHAVLTSIIGKDITHKMYSLNEQ 358 pea aphid
XP_002590395 165 -FIDSCEWEAFRLNQGKQFQVTITAESPCRYICWPREHLKYYLQMDPFLDAVFHNIIGKDIITKLYLLNEQ 234 Florida lancelet
XP_027310575 197 -FIDSPEFRSTQMNRGEKFQVTIIADDNCKFLCWSRERLTYFLESEPFLYEIFKYLIGKDITNKLYSLNDp 266 mallard
XP_001952663 211 --QFLDSPEWFGVSTDEFFQVSVTAVEDSRVLLWHRDKLRLSIITDKFLYTIFDHILGRDVVKKLMQVSET 279 pea aphid
XP_002134557 257 --QFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKLKLSIMAEPFLQTVFDHILGRDVVKKLMQVTQV 325 Drosophila pseudoobscura
EEC05992     194 --EFLDSPRWFYSSGGDLGQVTTTALEKCKVILWNREEVKVAISKDTYLKSVFDNVVASDVVRKLRFVTEK 262 black-legged tick
EEC01444     208 --EFLESCEWFEAPDSDQYQVTATAMGACKVFVWKREPLRKAVSRDFHLKAAFENILAKDMARKLHTMKSL 276 black-legged tick
XP_030346695 197 -FIDSPEFRSTQMNRGEKFQVTIIADDNCKFLCWSRERLTYFLESEPFLYEIFKYLIGKDITNKLYSLNDP 266 Kakapo
XP_002127439 180 -MIDSPEWQSTKLKRGESFQVTIEAVDRCFYLCWNREKLQYYLQVNPKLEEAFKYIRGKDVMDKVYQTTIN 249 vase tunicate
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap