Conserved Protein Domain Family
Arm_2

?
pfam04826: Arm_2 
Armadillo-like
This domain contains armadillo-like repeats. Proteins containing this domain interact with numerous other proteins, through these interactions they are involved in a wide variety of processes including carcinogenesis, control of cellular ageing and survival, regulation of circadian rhythm and lysosomal sorting of G protein-coupled receptors.
Statistics
?
PSSM-Id: 398480
Aligned: 8 rows
Threshold Bit Score: 295.098
Threshold Setting Gi: 47219766
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8BHS6       112 NSDDTv-LSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVK-EKALIVLNN 189 house mouse
Q6A058       529 YEIDEi-LGVRDLRKVLALLQKSDDPFIQQVALLTLSNNANYSCNQETIRKLGGLPIIANMINKTDPHIK-EKALMAMNN 606 house mouse
Q6PB60       306 CKLECy-LDSPEFEKLVNILKSTTDPLIHKIAQIAMGIHKVHPFAQEFINEVGVVTLIESLLSFSSPEVSiKKAVITLN- 383 house mouse
Q3UZB0       349 CKSRTfsLEPVDFDKLVALLKLTRDPFIHEIATMIMGISPAYPFTQDIVHDVGITVMIENFVNNPNAKKY-PRTLN-INA 426 house mouse
Q5RDG2       300 CKSRGfsLEPKEFDKLVALLKLTKDPFIHEIATMIMGISPAYPFTQDIIHDVGITVMIENLVSNPNVKEH-PRALSMVDD 378 Sumatran orangutan
Q8N2F6        87 GSYDDv-LNAEQLQKLLYLLESTEDPVIIERALITLGNNAAFSVNQAIIRELGGIPIVANKINHSNQSIK-EKALNALNN 164 human
CAG03393      82 ihassgnLEPQHLKVLLSRLQSSGDPAESQRILLTLGNAAAFTVNQNLIRDYEGIGTIAAFLSDPAAEVR-VQTLNALNN 160 spotted green p...
XP_002933149  69 ASVSD--LQPHHLANLLDILVTSSDSSLQEKVLITLCNSAAFSANHDIIRSLGGITIIAKSLSDSSEQIK-VNALNALNN 145 tropical clawed...
Q8BHS6       190 LSVNAENQRRLKVYMNQVCDDTVTSRLNSSVQLAGLRLLTNMTVTNEYQHILANSISDFFRLFSAGNEETKLQVLKLLLN 269 house mouse
Q6A058       607 LSENYENQGRLQVYMNKVMDDIMASNLNSAVQVVGLKFLTNMTITNDYQHLLVNSIANFFRLLSQGGGKIKVEILKILSN 686 house mouse
Q6PB60       384 -SSGDDRYNKVEFHVKHMCKETVSFPLNSPGQQSGLKIIGQLTTESVHHYIVVSYFSELFHLLSQGNRKTRNLVLKVFLN 462 house mouse
Q3UZB0       427 NPDAPEEVKETEAHVNKVCRDILCCPLNCSVQVEELKLLVSLSVKFDYHHVVIYYVRYFISLLNKGSVKIKFQILRVLLC 506 house mouse
Q5RDG2       379 SSESSEGPKSGESYIHQVCKGILSCPMNSPVQLAGLKLLGHLSVKFEDHYVITSYIPDFLTLLNKGSVKTKFYVLKVFSC 458 Sumatran orangutan
Q8N2F6       165 LSVNVENQIKIKIYISQVCEDVFSGPLNSAVQLAGLTLLTNMTVTNDHQHMLHSYITDLFQVLLTGNGNTKVQVLKLLLN 244 human
CAG03393     161 LSMNVRNQDQIKVCVPQVLELIEVSPVNSELQLAALRLLTNLSVTDQHQHLFKTSIRLLLSLLVVGNEEL---------- 230 spotted green p...
XP_002933149 146 LSMNVQNQELIKDYINQTCSAISLSSLNSEVQLAGLRLIINMSVTDNYHNMVADHLPCFLYLLAEGNNIIqIYTLKVLVN 225 tropical clawed...
Q8BHS6       270 LAENPAMTRELLRAQVPSSLGSLFNKKEYKEVILKLLIIFENINDNFKWEenEPAQNHFSEGSLF-FFLKEFQVCADKVL 348 house mouse
Q6A058       687 FAENPDMLKKLLGTQVPSSFSSLYNSYVESEILINALTLFEIIFDNLRAE--VFNYREFNKGSLF-YLCTTSGVCVKKIR 763 house mouse
Q6PB60       463 MSENPKAARDMINMKALAALKLIFNQKEAKANLVSAVAIFINIKEHIRKGsiVVV-DHLSYNTLT-AIFREVK------- 533 house mouse
Q3UZB0       507 LSKNQANTRELISAEVMSSLVALFHKNESKANILHIIEIFENINFQFKKRakLFTKEMFTKSELI-SIFREAKEFDQKLQ 585 house mouse
Q5RDG2       459 LSKNHANTRELISAKVLSSLVAPFNKNESKANILNIIEIFENINFQVKTKakLFTKEKFTKSELI-SIFQEAKQFGQKLQ 537 Sumatran orangutan
Q8N2F6       245 LSENPAMTEGLLRAQVDSSFLSLYDSHVAKEILLRVLTLFQNIKNCLKIEghLAVQPTFTEGSLF-FLLHGEE-CAQKIR 322 human
CAG03393     231 --------------QAPASVLLLFDAQTASPVLLRLLTFAGNL-RAWRPSaqVAHLLRQTQDCLFrVMLDESSQLNGRLF 295 spotted green p...
XP_002933149 226 LSANPTMTQTLLTAKGSQSLTSLFDSRVDREILVRVLIFAANLSKHLGSGhgYDLHANYNEDCLFnLLYGDSSPLQKDIT 305 tropical clawed...
Q8BHS6       349 GIESRHDFQVRVKVG 363 house mouse
Q6A058       764 ALANHHDLLVKVKVI 778 house mouse
Q6PB60       534 ------------GII 536 house mouse
Q3UZB0       586 DLTDHSDPDVRDKVI 600 house mouse
Q5RDG2       538 DLAEHSDPEVRDKVI 552 Sumatran orangutan
Q8N2F6       323 ALVDHHDAEVKEKVV 337 human
CAG03393     296 RLLSHPDGEIQAQVa 310 spotted green pufferfish
XP_002933149 306 ALFQYPDVEVKEQVV 320 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap