Conserved Protein Domain Family
DUF716

?
pfam04819: DUF716 
Family of unknown function (DUF716)
This family is equally distributed in both metazoa and plants. Annotation associated with a Nicotiana tabacum mRNA suggest that it may be involved in response to viral attack in plants. However, no clear function has been assigned to this family.
Statistics
?
PSSM-Id: 398474
Aligned: 84 rows
Threshold Bit Score: 79.5835
Threshold Setting Gi: 297811501
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KQJ98573     122 VAALAASVFGQELFLLRLHSADHSGLEGHYHWLLQLVVTASLVVSCASVV-LPRSFAVAVVRAASVLLQGVWFVVMGFVL 200 stiff brome
Q5T9Z0       100 EKGTLVLIIYELLLLMVSHVKDSEGVELHVYSLLILVVFLLLLVLTAELW-APNMCHLQLMETFLILMMGSWLMQAGFIL 178 human
XP_003410903 129 EQGAQALAFFMCLPLMVSHIQDTEGVELQAHILLIQAMFLLMLVVTAELW-APNMPQIWVMKAFLHMVVGSWLIHIGFML 207 African savanna...
EFB13589     129 EQGAQALGMFLFLPLMVSHMQDSEGVELQSHILLTQAIFLLVLVVIAELW-APDMLQLWVMKAFFYMMTGSWLIQIGFML 207 giant panda
XP_005639455 123 TKLMLSNALFVEAFIMYNHTHGRDMLDIFVHQLLVLAIFVTGLIAFLELF-IRTSITVELLRTSFIFLQGSWFWQIGFVL 201 dog
XP_019695179 123 IKLLLSNALFVEAFILYNHTHGREMLDIFVHQLLVLAVFVAALLGFLEFF-VRNNVIVELLQMTFILLQGSWFWQIAFVL 201 domestic cat
XP_003418992 123 AKLMMSNAFFVEAFVFYNHTHGRDMLDVYVHQLLLLVIIVTGLITFIDFM--RSNIILELLQPSFILLQGTWFWQIGFVL 200 African savanna...
XP_013218209 136 IKLMMSNAFFVESFIFYNHTHGREMLDIFVHQLLVLVSFLTGLMAFIEFL-TQKNILLELLRSSFVLLQGCWFWQIGFVL 214 thirteen-lined ...
XP_017453558 121 SKLMLANAIFVETFIFYNHTHGREMVDIFVHQLLSYTTTAAGLVAFMEFL-TKNNVLLELVRSSLILLQGTWFWQVAFVL 199 Norway rat
AAI72084     136 ITLMLSNIFFVEAFLIHNHPKSLIVVDSYVHQLLKFSALLAGLAAFIEFLlTKNNVVMELLRSSLTMLQGACFVQIGFIL 215 house mouse
KQJ98573     201 WFPAfvpagcrgmetvedegsmamamrSAVACDTeeAARRAAAMANLQFSWALAAVWVVTACLC 264 stiff brome
Q5T9Z0       179 YRPV-----------------------SGYPWQD--DDISDIMFVTTFFCWHVMINASFLLGIY 217 human
XP_003410903 208 FKPI-----------------------SGYKWMD--DDKNDIMFVTTFFCWHVAFAAVLMTWIY 246 African savanna elephant
EFB13589     208 YKPI-----------------------SGYKWMD--DDKNNIVFVTTFFCWHVAFIAILMIWVY 246 giant panda
XP_005639455 202 YPPS-----------------------GGPAWDT--MDHNNVMFLTICFCWHYALNIVVVGMIY 240 dog
XP_019695179 202 YPPS-----------------------GGPAWDS--MDHDNIMFLSTCFCWHYTLHIVIVGVIY 240 domestic cat
XP_003418992 201 YPPS-----------------------GGPAWEP--TDHDNIMFVSICFCWHYMFSLIIVGLIY 239 African savanna elephant
XP_013218209 215 FPPG-----------------------GRTAWDL--LDHNNIMLLAVGICWLYALAFIVIGANY 253 thirteen-lined ground squirrel
XP_017453558 200 YPPK-----------------------GRATWNL--SDIGNKMFLSMCFCWHYASIVMLIGVIF 238 Norway rat
AAI72084     216 YPKD-----------------------MEHAWDL--NDVNNTIILSIYFGVYYASTYVIIGVNY 254 house mouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap