6Q56


Conserved Protein Domain Family
TrmK

?
pfam04816: TrmK 
Click on image for an interactive view with Cn3D
tRNA (adenine(22)-N(1))-methyltransferase
tRNA_MT is a family of bacterial tRNA (adenine(22)-N(1))-methyltransferase enzymes with a Rossmann-like fold. This enzyme carries out the function of N1-adenosine methylation at position 22 of bacterial tRNA.
Statistics
?
PSSM-Id: 398472
Aligned: 12 rows
Threshold Bit Score: 227.186
Threshold Setting Gi: 81551934
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6Q56_B    23 MADIGSDHAYLPSYAVLNHKASGAIAGEITDGPFLSAKRQVEKSGLNSHISVRQGDGLEVIKKGE-A-DAITIAGMGGAL 100 Bacillus subtilis s...
CAC99531  23 IADIGSDHAYLPCFAVKNQTASFAIAGEVVDGPFQSAQKQVRSSGLTEHIDVRKGNGLAVIEKKDvI-DTIVIAGMGGAL 101 Listeria monocytoge...
P75427    20 FYDIGCDHGYLARELVQQNPSLVGVNSDISANALGAAKGLLKDHTNMHFI---TSDGFDLLPNLNlDpAVGVIAGLGGLK 96  Mycoplasma pneumoni...
Q9RXN4    22 HADIGTDHARLPLRLVRGGRVSRCVAVELNPGPLALARRMVARARLTEQIDVRQGDGFAPIQPGE-L-GSASVTGMGAYT 99  Deinococcus radiodu...
Q9KD40    23 LADIGSDHAYLPCYLCLKGVVEFAIAGEVNEGPYQSAVEQVQKVNLGHVISVRKGDGLAVIRADDqI-DTVTIAGMGGTL 101 Bacillus halodurans
Q9CGM4    23 LADIGSDHAYLPTYLMQKLVIDFAVAGEVVKGPFEIAKNHVSEADLSDRIEVRLANGLGAIENTDkI-DTIVIAGMGGIL 101 Lactococcus lactis ...
Q8DNY3    19 LLDVGSDHAYLPIELVERGQIKSAIAGEVVEGPYQSAVKNVEAHGLKEKIQVRLANGLAAFEETDqV-SVITIAGMGGRL 97  Streptococcus pneum...
Q9A050    22 LLDVGSDHAYLPIFLVETNQISAAIAGEVVRGPYESALKNVTQSGLAEHIQVRLANGLAAFEEADdV-TAITICGMGGRL 100 Streptococcus pyoge...
Q8DT98    27 LLDVGSDHAYLPIYLLEQGLIDFAVAGEIIKGPYESAVANVSESELSGQIAVRLADGLAALNDNDdI-DLITICGMGGRL 105 Streptococcus mutans
Q2FY13    20 IADIGSDHAYLPIYAIQNHLCECGIAGEVIQGPFQAAVKNVAANQLVDRIDVRLGDGLSVIQPEDvI-DNITICGMGGPL 98  Staphylococcus aure...
Q9PQE1    20 VVDVGSDHAYLAKILLVNNKAQHVTNIEVNQGPLENGINNLTKNNLLKRTTNILNDGFKGLILEQtF-DYCVIAGMGATS 98  Ureaplasma parvum
Q97JI1    20 AADIGTDHAYLPIYLIKNNLCKRFIASDVNAGPLKKAINNINKYKLEDKIECRLGSGLNVLKL-EeV-DVVVIAGMGGNL 97  Clostridium acetobu...
6Q56_B   101 IAHILEAGKDKLTGKERLILQPNIHAVHIREWLYKERYALIDEVILEEDGKSYEVLVAEAGDRDA-AydgIsLSAGMLVG 179 Bacillus subtilis s...
CAC99531 102 IRTILEEGAAKLAGVTKLILQPNIAAWQLREWSEQNNWLITSEAILREDNKIYEIMVLAPSKKPV-A---W-TKQEIFFG 176 Listeria monocytoge...
P75427    97 IMQILAQHNNFL---KHFVLQPQSNIIELRRFLSANQWTITTETLVEERGFIYLVLAVDKTKAQTq----YlTEEQMILG 169 Mycoplasma pneumoni...
Q9RXN4   100 IRGILDRAGERLPPA--LVLQPNDSPLWLRTWARENSYHLRAERLLPG-YWAYPVLRLERAEGPDpAyadLpAAAALRYG 176 Deinococcus radiodu...
Q9KD40   102 ISTILEEGKRNLQTVRRLILQPNVHGKAIRQWLSDNGWRLQAEAILEEDEKIYELLIAERGSDED-Ly--VsKELDLLVG 178 Bacillus halodurans
Q9CGM4   102 ISEILEAGKEKLGHVKRLILQPNNHEESLRQWLVNHQFVIKKEEILLEAGKFYEIIVAEPLSKLMtE---KlSVNDLTFG 178 Lactococcus lactis ...
Q8DNY3    98 IARILEEGLGKLANVERLILQPNNREDDLRIWLQDHGFQIVAERILEEAGKFYEILVVEAGQM-------KlSASDVRFG 170 Streptococcus pneum...
Q9A050   101 IADILEAGKEKLQGIERLVLQPNNREDDLRAWLSVNAFKIVAETIMAENDKYYEIIVAEHGEK-------AlSATELRFG 173 Streptococcus pyoge...
Q8DT98   106 IADILAAGSDKLNSVKQLILQPNNCEDDLRSWLVANDFMIKAEKMVKDRHKYYEILVVEKGKI-------TlSDKDLRFG 178 Streptococcus mutans
Q2FY13    99 IAKILKDGQDKLSQHPRLILQSNIQTENLRQTLQQLNYEIIDEIIMEEKGHIYEIVVAEYSTELI-El----SSDELKFG 173 Staphylococcus aure...
Q9PQE1    99 IIEILEQNKNQ---IKNYILQPNTQSYKIRKYLNNHSYQIKVEHIFVEKKIFYEIIICSKTINVP-----KlIEKDYYIS 170 Ureaplasma parvum
Q97JI1    98 IRDIIEERLDIFKKLKYAVLQPVQNPEILREYLIKRGFNIIEEQLCIDESKYYEIIKVCYDSKIEdK-----DDVYYEIG 172 Clostridium acetobu...
6Q56_B   180 PFLAKEKNAVFLKKWTQELQHTQSIYEQISqa-adTEQNKQKLKELADRM-ELLK 232 Bacillus subtilis subsp. subtilis str. 168
CAC99531 177 PCLLKDQSAIFKSKWRHEANTWQNIIQTISnnqpvSPENQAKIRELEHKI-ALVE 230 Listeria monocytogenes EGD-e
P75427   170 PHLVNFTDKQMLVKYYNGLLK--------------NFTARLNPSQFDSQViHVLN 210 Mycoplasma pneumoniae M129
Q9RXN4   177 PLLLRKGPALLRARIEADIERLTPVAAP-------GREAWAELAAAREALaVVDA 224 Deinococcus radiodurans
Q9KD40   179 PYLRKERNAAFQKKWTAELISWKRVLSQLNka-kpSEELEAKKIELQKNI-SLIE 231 Bacillus halodurans
Q9CGM4   179 PFLSKEKSTVFQQKWQKELNTLNKIIARLP-----EEQAE-KRQEVLNQI-ARIE 226 Lactococcus lactis subsp. lactis
Q8DNY3   171 PFLSKEVSPVFVQKWQKEAEKLEFALGQIP-----EKNLE-ERQVLVDKI-QAIK 218 Streptococcus pneumoniae R6
Q9A050   174 PYLSQEKSVVFKEKWQREMDKLAYALSCIP-----EEKTQ-ERQLLLTKI-QQIK 221 Streptococcus pyogenes serotype M1
Q8DT98   179 PFLRQERSSIFKERWRKELAKLELALTKVP-----AKK-KADNMFLSTKI-EQIK 226 Streptococcus mutans
Q2FY13   174 PKLLNNKNEYFIKKWQRELEALYHIKSKLN-----TEQHHQRLAQINDEI-AVIE 222 Staphylococcus aureus subsp. aureus NCTC 8325
Q9PQE1   171 SQMHKDSLNLYFKFLKRRYEYLKALDISLV-----SENIVKEYEYIKEFInEKNG 220 Ureaplasma parvum
Q97JI1   173 DKLIDMKHPLLKEYINYKIRKYDKIYKNISe---eSLNALSRKNELSIKI-RKLK 223 Clostridium acetobutylicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap