1M2V,3EFO


Conserved Protein Domain Family
zf-Sec23_Sec24

?
pfam04810: zf-Sec23_Sec24 
Sec23/Sec24 zinc finger
COPII-coated vesicles carry proteins from the endoplasmic reticulum to the Golgi complex. This vesicular transport can be reconstituted by using three cytosolic components containing five proteins: the small GTPase Sar1p, the Sec23p/24p complex, and the Sec13p/Sec31p complex. This domain is found to be zinc binding domain.
Statistics
?
PSSM-Id: 398466
Aligned: 305 rows
Threshold Bit Score: 38.1948
Threshold Setting Gi: 343767888
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1M2V_B       228 IVRCRRCRSYMNPFVTFIEQGRRWRCNFCRLANDVPM 264 
XP_001313957  45 lCACSKCRAYIGPHSKIDMNTRTWTCAFCKTSNNLPI 81   Trichomonas vaginalis G3
EPY49580     149 IPYCTICGAYFSFHSNAIFSGSQWKCEFCDTCNNITD 185  Schizosaccharomyces cryophilus OY26
XP_002968157  36 PSRCEKCGAYPNLYSRLTPVSGQWQCMLCQKINSSNG 72   Selaginella moellendorffii
XP_009384141 182 PHRCRNCGAYANLYCEILVGSGQWQCVICKNLNSSDG 218  wild Malaysian banana
XP_002301552 195 PHRCHNCGAYANLYCKILLGSGQWQCVICQKLNGSEG 231  black cottonwood
XP_009111340 209 PHRCLHCGAYSNPYTSILIGSGQWQCVICEKMNGSKG 245  field mustard
XP_001581928  92 IPRCSKCSAYLSCFCTLSYDQRSWKCAICGNTTKFTP 128  Trichomonas vaginalis G3
EAY12219     110 IPRCSKCAAYLCPYTQGSPDGRSYTCAMCKSKNVLAD 146  Trichomonas vaginalis G3
EAY16641     103 IHRCSKCAAYLSPYIKLLTDGKSYKCPICDEIVHVNE 139  Trichomonas vaginalis G3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap