Conserved Protein Domain Family
CTV_P23

?
pfam04808: CTV_P23 
Citrus tristeza virus (CTV) P23 protein
This family consists of protein P23 from the citrus tristeza virus, which is a member of the Closteroviridae. CTV viruses produce more positive than negative RNA strands, and P23 controls this asymmetrical RNA accumulation. Amino acids 42-180 are essential for function and are thought to contain RNA-binding and zinc finger domains.
Statistics
?
PSSM-Id: 113574
View PSSM: pfam04808
Aligned: 3 rows
Threshold Bit Score: 427.952
Threshold Setting Gi: 81967807
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q66245   1 MDNTSGQTFVSVNLSDESNTATTDVEPVSSEADRLDFLQKMNPIIIDALIRKNSYQGARFRARIIGVCVDCGRKHDKGLK 80  Citrus tristeza virus
Q9DJS8   1 MNDTSGQTFVSVNLSDESNTASTRVENVKSEADRLEFLRKMNPLIIDALVRKTNYQGARFRARIIGVCVDCGRKHDKALK 80  Citrus tristeza virus
Q66258   1 MDNPSGQTFISVNLSDESNTASTETKAVSSEADRLEFLRKMNPFIIDALIRKNSYQGARFRARIIGVCVDCGRKHDKASR 80  Citrus tristeza virus
Q66245  81 TERKCKVNNTQSQNEVAHMLMHDPVKYLNKRKARAFSNAEIFAIDLVMYTKERQLAIDLAAEREKTRLARRHPMRSPEET 160 Citrus tristeza virus
Q9DJS8  81 TERKCKVNNTQSQNEVAHMLMHDPVKYLNKRKARAFSNAEMFAIELVLYTKEKQLAVDLAAEREKTRLARRHPMRSPEET 160 Citrus tristeza virus
Q66258  81 TERKCKVNNTQSQNEVAHMLMHDPVKYLNKRKARAFSNAEMFAIDLVMHTKERQLAVDLAAEREKTRLARRHPMRSPEET 160 Citrus tristeza virus
Q66245 161 PEYYKFGRTAKAMLPDINAVDVGDNEETSSEYPVSLSVSGGVLREHHFI 209 Citrus tristeza virus
Q9DJS8 161 PEHYKFGMTASAMLPELNAVGVGDNEDTSSEYPVSLSVSGGVLREHHFI 209 Citrus tristeza virus
Q66258 161 PEHYKFGMTAKAMLPNINAVDVGDNEDTSSEYPVSLSVSGGVLREHHLI 209 Citrus tristeza virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap