Conserved Protein Domain Family
EspF

?
pfam04806: EspF 
EspF protein repeat
The enteropathogenic Escherichia coli EspF secreted protein induces host cell apoptosis. Its proline-rich structure suggests that it may act by binding to SH3 domains or EVH1 domains of host cell signalling proteins.
Statistics
?
PSSM-Id: 398464
Aligned: 3 rows
Threshold Bit Score: 52.4532
Threshold Setting Gi: 124106609
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAF45430  96 IKPARSMAEHIPPAPNWPAPPPPVQNEQSRPLPDVAQRLVQHLAEHG 142 Escherichia coli O157:H-
Q2F7Y9   190 IQPARSMAEHXPPAPNWPAPSPPVQNEQSRPLPDVAQRLVQHLAEHG 236 Escherichia coli
EFX35099  25 IQPARNMAEHIPPAPNWPAPTPPVQNEQSRPLPDVAQRLMQHLAEHG 71  Escherichia coli O157:H7 str. LSU-61
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap