Conserved Protein Domain Family
SMK-1

?
pfam04802: SMK-1 
Component of IIS longevity pathway SMK-1
SMK-1 is a component of the IIs longevity pathway which regulates aging in C.elegans. Specifically, SMK-1 influences DAF-16-dependant regulation of the aging process by regulating the transcriptional specificity of DAF-16 activity. SMK-1 plays a role in longevity by modulating the transcriptional specificity of DAF-16.
Statistics
?
PSSM-Id: 398462
Aligned: 112 rows
Threshold Bit Score: 169.566
Threshold Setting Gi: 124448002
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_007328979  221 QEEYIKSLIDVLRAAEDL-ESLENLHALCSLMQTILMLNDHTLYEHILEDDIFYGVVGMLEYDPDFP-THKANYRDFLKQ 298  Agaricus bisp...
EEH55088      177 QNGYLRKLLDLFKTCEDL-DDQDGLHMMYRLVRGLVLLNDAALFDELLRDDNVMDVVGALEYDPDLP-VERTQHRVFLRD 254  Micromonas pu...
EFJ22511      210 EQSYIPKLMELFRLCEDL-ENVENLHMIFRIVKGMISLNDKNVFDTIFSDEHVMDVVGALEYDPELS-SQQ-DHRGFLKT 286  Selaginella m...
ERN03083      165 DRTFVPKLTDLFRVCEDL-ENVDGLRLMYKVVKGIISLNSPPIFERIFGDDYIMDIIGALEYDPEVP-QVQ-HHRAFLKE 241  Amborella tri...
Q8LPS4        167 DHDFFRNLMGVFKICEDL-ENVDGLHMIFNIVKGIILLNSSQILEKIFGDELIMEIIGCLEYDPGVP-HSQ-HHRNFLKE 243  thale cress
KRH11977      167 YQDFFGKLMDVFRVCEDL-ENMDGLHMIYKIVKGIILLNSTQIFERIFSDEFMMDIIGALEYDPEVS-HVK-HHRKFLKE 243  soybean
XP_006654069  203 YHDFFPQLVNLLRTCESS-GNMDALHMIFRLVKGIIFLNSSAIFDKIFSDDFILEIIGALEYDPEAR-SVQ-NHRYFLKE 279  malo sina
XP_006644141  198 ERDFFPKLLDIFRICEDL-ENLDDLHMIFKLVRGIILLNSSSIFDKIFSDEFILDIIGALEYDPDVP-KVQ-KHRAFLKD 274  malo sina
EFA75365      165 RDDYLKQLLELFDQLEQS-NDIPNLHHQFTIFKNLILFNDSSIFELLLSEEYLLRMMGVLEYDPEISeQNRIRHREFLSQ 243  Heterostelium...
Q54I18        149 KEDLVRSLLDLFDEIEKSgEGGVHLFQIFNIFKNLILFNDTSILEVILSEDYLVRVMGALEYDPEISeNNRIKHREFLNQ 228  Dictyostelium...
XP_007328979  299 AARFRQPIPMQEEVIQRKIHHTYRLQFLKDVVLARALDDSTFNVLNSCIIFNQIDIITHIQSDQMFLKEIVRLFVdedvl 378  Agaricus bisp...
EEH55088      255 SVVFKEVVPIQDADVRAKIHQTYRIGYLKDVILPRVLDDATFGTLTSIMLFNNVEVVLALQNDPTFLKELFARLD----- 329  Micromonas pu...
EFJ22511      287 QVVFKEAVPIHDVAIVSKIHQTYRIGYVKDVILPRVLDDQTFANMNSMMLANNKAVVSALHSDKTFVSDLFAKLR----- 361  Selaginella m...
ERN03083      242 HVVFKEAIPIKDPSVLSKIHQTYRVGYIKDVILPRALDEATIANLNSIVHSNNAYVVSLLKDDNAFIQELFARLR----- 316  Amborella tri...
Q8LPS4        244 HVVFKEAIPIKDPLVLSKIHQTYRIGYLKDVVLARVLDDAIVANLNSVIHANNAIVVSLLKDDSTFIQELFARLR----- 318  thale cress
KRH11977      244 HVIFKEAIPIKNTTVLSKIHQTYRVGFLKDVVLARVLDEATVANLNSIIHANNAIVVSLLKDDNTFIQELFARLK----- 318  soybean
XP_006654069  280 HAIFKEAIPIKSASVVSKIHQTYRIGYIKDVILPRVVDDATMASIAAIIHANNAAVVCLLKDDSSFVKELFTKMR----- 354  malo sina
XP_006644141  275 HVVFKEAIPIKNASVVSRIHQTYRIGYLKDVILPRVLDDATLASLNTMIHSNNAAVISLLKDDSCFIQELFARMR----- 349  malo sina
EFA75365      244 QVIFKEVVKFSSESLISTIHQTFRVQYLKDVVLPRVLDDLTFSTLNSIIYFNNSEIVGQIQKDTTFLQKIFTQIQ----- 318  Heterostelium...
Q54I18        229 QVVFKQVIKFPSKSLIGTIHQTFRIQYLKDVVLPRVLDDVTFSSLNSLIYFNNIDIVSQIQNDSDFLENLFSEIQ----- 303  Dictyostelium...
XP_007328979  379 iggaqryqiqlqmmqqqqqqmhqmhqrlqqgpddsmdvdtapkpipsvsppasapissptaysfappddLTEAEINQRRE 458  Agaricus bisp...
EEH55088      330 ---------------------------------------------------------------------NTPRTNPDWDD 340  Micromonas pu...
EFJ22511      362 ---------------------------------------------------------------------SPDISQNVRND 372  Selaginella m...
ERN03083      317 ---------------------------------------------------------------------SPATSVESKKN 327  Amborella tri...
Q8LPS4        319 ---------------------------------------------------------------------SPSTSMESKKN 329  thale cress
KRH11977      319 ---------------------------------------------------------------------SPATSPESKKN 329  soybean
XP_006654069  355 ---------------------------------------------------------------------SSNISAESKRE 365  malo sina
XP_006644141  350 ---------------------------------------------------------------------LPSISMESKRE 360  malo sina
EFA75365      319 ---------------------------------------------------------------------QSPSGSSERRD 329  Heterostelium...
Q54I18        304 ---------------------------------------------------------------------KSEKNSEERKD 314  Dictyostelium...
XP_007328979  459 VVLLIQQLCIMGKNVQLPARMALFR 483  Agaricus bisporus var. burnettii JB137-S8
EEH55088      341 LVGFLQELCSLAKHLQIQQRGSLFA 365  Micromonas pusilla CCMP1545
EFJ22511      373 LIYFLHEFCNLSKNLLSLHRSELFG 397  Selaginella moellendorffii
ERN03083      328 LVLFLQEFCSLSKSLQLVHQMRLFR 352  Amborella trichopoda
Q8LPS4        330 LVYFLHEFCSLSKSLQVVQQLRLFR 354  thale cress
KRH11977      330 MVHFLHEFCSLSKSLQMVHQLRFFR 354  soybean
XP_006654069  366 LVLFLLEFCTLSKSLQPVQQLQLSR 390  malo sina
XP_006644141  361 LVLFLHEFCTLSKSLPLVQQLRLFR 385  malo sina
EFA75365      330 LLLFLQELCGLAKNLQIQNKSTFFL 354  Heterostelium album PN500
Q54I18        315 LILFLQDLCNLAKGLQIQSKSTFFT 339  Dictyostelium discoideum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap