2I5I


Conserved Protein Domain Family
YdjC

?
pfam04794: YdjC 
Click on image for an interactive view with Cn3D
YdjC-like protein
Family of YdjC-like proteins. This region is possibly involved in the the cleavage of cellobiose-phosphate.
Statistics
?
PSSM-Id: 398457
Aligned: 183 rows
Threshold Bit Score: 109.606
Threshold Setting Gi: 81424149
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2I5I_B          6 KLIINADDFGYTPAVTQGIIEAHKRGVVTSTTALPTSPYF-LEAXEsArisapT-----LaiGVHLTLTLnqAkpI---- 75  Enterococcus f...
MSU:OCAR_7265   6 RITLCADDYGISDGVNRAIRDLIAQRRLNATSVMVVGPAIgREDADaLravvdNnc--eI--GLHVTLTApfSp-Ltmhy 80  Oligotropha ca...
Q20X94          8 RIWLCADDYGLSPGVNRAIRELIAARRINATSVMMVGPSIgRDEAEaLkavvaDnpdcaI--GLHATLTApfSp-Ltlqf 84  Rhodopseudomon...
Q6NAN6          8 RIWLVADDYGISPGVNRAIRDLIERGRINATSVMMVGPAIgRDDAAeLlnaaaAnphaaI--GLHATLTApfAp-Ltmhy 84  Rhodopseudomon...
WP_009734328    8 RIWLCADDYGMSPGVNRAIRKLIEQKRLNATSVMVVGAAIdRAEIDgLlqsvaTnpncaI--GLHATLTApfAp-Ltlhf 84  Bradyrhizobiac...
Q89DB2          9 RIWLCADDYGISPGVNRAIRDLIERGRLNATSVMMVGPAIaRGEIEaLeaaakTsprcaI--GLHVTLSApfRp-Ltmhf 85  Bradyrhizobium...
WP_012029651    8 RIWLCADDYGISPGVNKAIRDLIARGRLNATSVMTVGAAIgRDEVAeLtkvaaDsprcaI--GLHVTLTApfRp-Ltmhf 84  Bradyrhizobium...
Q3SPH0         19 RIRLCADDYGISPGVNRAIRDLIERERINATSVMVVGPAAgRDEVEaLktaasRhphcaI--GLHLTLTApfHp-Ltlhy 95  Nitrobacter wi...
jgi:Xaut_2351   3 HVVLCADDYAISPGVSEAIRRLITARRINATSVMTVFDGL-IEEADaLkaaaaErd-vsI--GLHVTLTGtfP--Pltrg 76  Xanthobacter a...
BAF87471        3 RIVICADDYGIAPGVSAAIRALLAERRINATSVMTVLPDL-FEEADaLmpltsGqa--sI--GLHVTLTGnfEpl----t 73  Azorhizobium c...
2I5I_B         76 LPRE-----XVPSLVDeagyfwhqsifeekVNL------EEVYNEWDAQIISFXKS-GRRPDHIDSHHNVHGKNKkLLGV 143 Enterococcus f...
MSU:OCAR_7265  81 RPLDggmfwPLQRLLR--------------GALlrridaDFVESEVKAQITLFRDLfGAPPAYLDGHQHVQLFPG-IRDG 145 Oligotropha ca...
Q20X94         85 RPLDgglflPLAQLLQ--------------QSLlrrldrGFFRTELAAQFAAFGNLfGRAPDYVDGHQHVQLFPQ-IRDA 149 Rhodopseudomon...
Q6NAN6         85 HPLHggqflPLGRKLR--------------GTLlrrhdrAVIATELSAQIEAFTDRfGRPPDYIDGHQHVQLFPQ-VRDA 149 Rhodopseudomon...
WP_009734328   85 RPLDggqflPLGRLLR--------------ASLlrrldpEIVHAELLAQIAAFRQMfGRAPDYIDGHQHVQLFPQ-IRDA 149 Bradyrhizobiac...
Q89DB2         86 RPLDgdmfmPFPKLLR--------------AGVlrrldrEFFRNEVKAQLVAFTEAfGRAPDFVDGHQHVQLYPQ-VRDG 150 Bradyrhizobium...
WP_012029651   85 RPAEggmflPFPRLLR--------------AGLlrrldpEMIRAEVAVQLTAFGELfGRAPDFVDGHQHAQLYPQ-VREG 149 Bradyrhizobium...
Q3SPH0         96 RPLDgglfpPLSKMLR--------------ASLsrrlepDMIFDEVTAQIAAFGERfGRAPEYVDGHQHVQIFPQ-VRDA 160 Nitrobacter wi...
jgi:Xaut_2351  77 MAGAngcfpALSQVVL--------------AALsrrldaKAVAAEVEAQFEAFLTAfGRPPDHVDGHQHVHVLPV-VRKA 141 Xanthobacter a...
BAF87471       74 HGFKgatfpSLGRLMA--------------MSFarrldpVNVKAEIETQFLAFEEAfGRPPDHVDGHQHVHLLPT-IREA 138 Azorhizobium c...
2I5I_B        144 ALALArkyqlplrnasrsietkdylel----------------------yqdvrtpdexlyqfydkaistETILQ----L 197 Enterococcus f...
MSU:OCAR_7265 146 FIRAAretapdawarqcrraqassrlgnpkailldtl-sttfrkrcaasglptntafagaydfrklpdfgSLMRSflasL 224 Oligotropha ca...
Q20X94        150 FLEAVadatpdawvrqcgrmqplsqrvampkallldvlstpfrarasradiafnpgfagaydflkqsdfaGLMRGfldgL 229 Rhodopseudomon...
Q6NAN6        150 FLGAVktlapdawvrqcgrsvpltrrlgnpkpllldalsapfrnraaqagiafnsgfagaydflretdfdTLMGSflhgL 229 Rhodopseudomon...
WP_009734328  150 FLAAVkeaapnawvrqcgrslplserlgnpkallldtlsdtfrkkavhegiafntgfagaydmvrgrdfaDAMTEflagL 229 Bradyrhizobiac...
Q89DB2        151 FIDAVsetapnawvrqggrdlplaqrlaspkamvldilsaqfrrraagaglgfnpgfagaydftraadfgALMRQflegL 230 Bradyrhizobium...
WP_012029651  150 FLAAVkeaapsawvrqggrnlplmqrlaapkallldvlsaqfrrhaararipfnpafagaydftkasdfgALMDGflndL 229 Bradyrhizobium...
Q3SPH0        161 FLNAVktaapgawvrqcgrsrhsmttlfttpkallldilsagfrreaartgigfnpafagaydfnkpdfaAQMQQflngS 240 Nitrobacter wi...
jgi:Xaut_2351 142 VLAATarfaprawlrdvtpaksalhgfdakgrligaf-asgfardaarlglatnrgfggaydfsadhdfaTLLTHflkgV 220 Xanthobacter a...
BAF87471      139 VLEVTrsrapeawvrdctpapgalvgldlkgryigfl-argfaaeakalglatnrgfagaynfkmgtnfgRLLTQfisgL 217 Azorhizobium c...
2I5I_B        198 ldxvvcSEGevFEINCHPAFidtilqnqsgycxpRIREVEILTSQEVKEAIEE 250 Enterococcus faecalis V583
MSU:OCAR_7265 225 ------PEG--GLVMCHPGFvddtlraldpltdqRAREHAYLASEDFPRLLAE 269 Oligotropha carboxidovorans OM5
Q20X94        230 ------PDG--GLVMCHPGYvddtlialdpltdqRERERMFLHSEAFVELIAT 274 Rhodopseudomonas palustris BisB18
Q6NAN6        230 ------PDG--GLVMCHPGEvddtlisldpftdqREREYAYLGSDRFPELLAK 274 Rhodopseudomonas palustris
WP_009734328  230 ------PDG--GLVMCHPGYvdeiligldnvthqRERELAFLSSDGFPRLLAd 274 Bradyrhizobiaceae bacterium SG-6C
Q89DB2        231 ------PDG--GLVMCHPGFvddvlaaldpmtdvREREHAYLGGDEFVRLLAQ 275 Bradyrhizobium japonicum
WP_012029651  230 ------PED--GLVMCHPGFvddvlieldpltvqREHEHAYLAGEHFPDLLAR 274 Bradyrhizobium sp. ORS 278
Q3SPH0        241 ------PDD--GLIMCHPGFvddtlvafdpltdqREREYEFLAGDHFADMLAA 285 Nitrobacter winogradskyi Nb-255
jgi:Xaut_2351 221 ------PDG--GLVMVHPGRvddpltardpltqqREVEYAVLHGATLRDILDA 265 Xanthobacter autotrophicus Py2
BAF87471      218 ------EDG--GVVMVHPGMvdealgkrdpltspREAEYEVLAGAQLPQILla 262 Azorhizobium caulinodans ORS 571
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap