4JBU


Conserved Protein Domain Family
LcrV

?
pfam04792: LcrV 
Click on image for an interactive view with Cn3D
V antigen (LcrV) protein
Yersinia pestis, the aetiologic agent of plague, secretes a set of environmentally regulated, plasmid pCD1-encoded virulence proteins termed Yops and V antigen (LcrV) by a type III secretion mechanism. LcrV is a multifunctional protein that has been shown to act at the level of secretion control by binding the Ysc inner-gate protein LcrG and to modulate the host immune response by altering cytokine production. LcrV is also necessary for full induction of low-calcium response (LCR) stimulon virulence gene transcription. Family members are not confined to Yersinia pestis.
Statistics
?
PSSM-Id: 398456
Aligned: 2 rows
Threshold Bit Score: 478.027
Threshold Setting Gi: 81418543
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4JBU_A   1 GHmGSSVLEELVQLVKDKNIDISikydprKDSEvfanrVITDDIELLKKILAYFLPEDAILKGGHYDNQLQNGIKRVKEF 80  Yersinia pestis
Q7N0X1  27 GS-GSSELDRLVNLIFDKGIKIT------SDSS-----VVTENKELLKKLIAYFLPADAVVEGGHLDSQIKNGINNLESF 94  Photorhabdus laumondi...
4JBU_A  81 LESSPNTQWELRAFMAVMHFSLTADRIDDDILKVIVDSMNHHGDARSKLREELAELTAELKIYSVIQAEINKHLSSSGTI 160 Yersinia pestis
Q7N0X1  95 LNSSTLKTWTLKDFLAAVHFNLTPDRLDDDVIDIFVSVMSGHDKKRLELRDELATLTAELKIYSVIQSEINAKLAANGEL 174 Photorhabdus laumondi...
4JBU_A 161 NIHDKSINLMDKNLYGYTDEEIFKASAEYKILEKMPqttiqvDGSEkkiVSIKDFLGSENKRTGALGNLKNSYSYNKDNN 240 Yersinia pestis
Q7N0X1 175 KIDDNSFNLLDHKKYGFSDQPTFEKSAEYKLLRKIS------SGSE---ISIKTFLESSNKQSGAMAGLENSYEYDKENN 245 Photorhabdus laumondi...
4JBU_A 241 ELSHFATTSSDKSRPLNDLVSQKTTQLSDITSRFNSAIEALNRFIQKYDSVMQRLLDD 298 Yersinia pestis
Q7N0X1 246 RLANFSTSVNDRVSPLNNTVQEKTTRLNEASSRYNAAIEALNRFIQKYDSIIRNILGA 303 Photorhabdus laumondii subsp. laumondii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap