Conserved Protein Domain Family
DUF621

?
pfam04789: DUF621 
Protein of unknown function (DUF621)
Family of uncharacterized proteins. Some are annotated as having possible G-protein-coupled receptor-like activity.
Statistics
?
PSSM-Id: 398453
Aligned: 15 rows
Threshold Bit Score: 340.456
Threshold Setting Gi: 0
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003112400   32 ETVPDVQKTWIYYIVISCFVLTAIASTLLTGGFLVMSVVLWNHLKT--------MKFFWFLTQLTFSSFMISILNLIFNV 103  Caenorhabditi...
CAO82042       37 AEIPPEDKNFLYYFIIATFTASTIISTLLTGAFLVASVILWKRFKH--------MKFFWFLCMLTLSIFIISILNLLINV 108  Caenorhabditi...
EFP11074       63 AEIPPEDKEGVYYFIVTLFVFATFASTLMTGAFLAMSIALWGHFKQawkkfhlnMKFFWFLTQLTIAVFIMSSLNFLINV 142  Caenorhabditi...
CAP29162       32 AEVPPQQKTSLYYLVITLFVISVIACTLLTGAFLVLLILLWGQFKS--------IKYYWFLSQLTVSVFFLSSLNLVINV 103  Caenorhabditi...
Q6BES6         30 dTLPESEKNWMFYFVILLFVLSTVTATLLTASFLIMAVFLWNHLKP--------MKFFWFLLQLTISAFILSTLNLVFNV 101  Caenorhabditi...
EGT32880      309 GEIPEDQKQGTYYFVVSFFVFSTIVSSLLTSVFLVLAITVWNHFKR--------IRFFWFLIHLLISVFIISASNLLMHV 380  Caenorhabditi...
O44177         14 lDISDSEKNWLYYSVVSFFVVSTIGATILTMSFLVLSILLWRHFKS--------MRFFWFLTQLTTSAFVISAANLFINI 85   Caenorhabditi...
NP_507594      13 LEISGSDKNWIYYCVVSFFIISTLGATVLSAGFLVLSVYFWTHFRS--------IRFFWFLTQLTTSTFIISASNLFINI 84   Caenorhabditi...
EGT32880        1 ---lplsQKWTLLSIVGLFVTTTVVSTLLTAAFLVLSILLWSHFKH--------IRFFWFLVQLILSVFIISGSNLLIHV 69   Caenorhabditi...
NP_506279      29 AEVPPEEKGPGYYLVTTLFVVSIIASTLLTGSFLVLLLLLWKHFKS--------LKYFWFLMQLTLSVFILSTLNLVINV 100  Caenorhabditi...
XP_003112400  104 PATLLSVATKQLVPSELYFIVLYLMDFFLHSILFSNLVIAFQRLFVFFPSKKMEF--LFGTPLLYLWMILIYTLPIFILF 181  Caenorhabditi...
CAO82042      109 PATLFSLLTKDFVKSEAFLLISYIIDICHYTILFCNLVIAVQRCFVFFFRNLADS--VFDTPFMYAWMISVYLLSLLVVY 186  Caenorhabditi...
EFP11074      143 PATLFSLITKEFVKSDAFFLMSNVIDFCHNAVLFSNLLIAIHR------------------PLVYIWMILVWILSGAVVL 204  Caenorhabditi...
CAP29162      104 PATLFSLLTPDFVTSDIYIILSYTADYMHYSILISNLVIAIQRFSVFLFRNYSST--LFDSHFVYIWLVIVWLAPGAIIF 181  Caenorhabditi...
Q6BES6        102 PATLFSVATEQFVQTNLYLIMSYVIDFCLHSILFSNFVMAIQRFAVFFHLHISDI--IFESPYIYIWLVMIYVLPSLTLI 179  Caenorhabditi...
EGT32880      381 PASL-GLIEEHHFETEIFHFISYLIDFCHYSILFSNVVIAINRAVIFFQNSSSYSniVFEPPFIYIWLSVVWLLSFGVES 459  Caenorhabditi...
O44177         86 PAAL-SLFSKEVTQSRMFYFVSYLIDFCHYSILFSNLVIAVQRAFVFFLRNLTDR--FFESKVIYIWISSIYIFAFGVEY 162  Caenorhabditi...
NP_507594      85 PAAL-SLFPKEVTQSELFYFVSYLIDFCHYSIIFSNLVIAVQRGFVFFLRNLTEQ--LFESKIIYIWLASIYIFSFGVEF 161  Caenorhabditi...
EGT32880       70 PATL-GLLSPSTLNSEIFIFVTYLIDFSHYSIIFSNTVIAINRGVLFFKKSSVAAk-TFESPFIFFWFLLIWLMPLGIDY 147  Caenorhabditi...
NP_506279     101 PATLFSLITKDFVASDVYTTLSYTIDYFHYAILISNMVIAIQRFCVFFFRQLTAK--IFDSFIIYEWLCLVWILPAIILL 178  Caenorhabditi...
XP_003112400  182 SLFQNDCSYKY-NAIEQ--------KFKLYCPKVVsgieSLTKEPPEGIQILENVIQVGIPVVILVLYIALVIRVIKLKR 252  Caenorhabditi...
CAO82042      187 AMMYNNCRYRY-SLNVL--------HYELYCQTSA----VVNLPPPKAISIMEIVIQFAIPCIIFGIYIALTIKIMIMKQ 253  Caenorhabditi...
EFP11074      205 SMMSKNCRYEYdMAVLE--------HYVLKCRTESg----IAISPSSVIQMIEIAMQFVIPIFILAVYIALVAKICTIKQ 272  Caenorhabditi...
CAP29162      182 FMAYNNCRYVFlKAKKD--------NFVLKCETAGs---VVDLPQPEWIRFMELALQFGIPVLIFCMYVAVVFKICSMKK 250  Caenorhabditi...
Q6BES6        180 FLGQDNCMYRF-DNREQ--------KFTLTCFNTVgt-nKVKIEIPRIIQIIEDTIQIVIPIIILILYIALVIKIIKMKK 249  Caenorhabditi...
EGT32880      460 VLISYDCSYKY-NHLRT--------RLQFICQKPAes-slIFLGNPRIIQVIDAIIQIALPVLILLIYFSIILRMILMKK 529  Caenorhabditi...
O44177        163 ALMSSNCQYRF-GELAR--------KYQLICETTNyanvVITMTTPTEVQLMETMLQIFLPLSILIIYIAITVKIIYMKG 233  Caenorhabditi...
NP_507594     162 TLMISNCQYRF-GETASgkysgnsgKYQLICETVGygniIISMATPAGVQLMETVLQIGIPIFILCIYFAIITKIVSMKG 240  Caenorhabditi...
EGT32880      148 VLMSAGCRIQL-NLKMK--------NFRMKCEKYSnf-fLIHTETPLGIQIIDVLLQIGLPAFIFLIYSSIVVSIAFARN 217  Caenorhabditi...
NP_506279     179 ILVFNNCKYNF-KKAPS--------NFVLNCQPWGs---IVDLPPPRWIQILELVVQFGIPFFILFLYIAVIFKIFAMKK 246  Caenorhabditi...
XP_003112400  253 SKRNTNEIIILKQAFFIFVMFQIYNIVTLFGKTLYINVATAFYLKRAIHTA--------------EIFAGAATPCIVFST 318  Caenorhabditi...
CAO82042      254 SSLKSSEITILKQAFFVFFVFQVSSVVFLLCQTVKFGVATAFLIKRVINTM--------------EILAGAATPCFFFFT 319  Caenorhabditi...
EFP11074      273 GAQNNYELTILKQAVFIFALFQISSIVFLLCQTLKFKVATAFLIKRVINTVnqcmsnyksfeiqtEIFAGAATPCFFFFT 352  Caenorhabditi...
CAP29162      251 SALNKQETRVLVQAIIIFLLFQASSTVFLFCQTLSFNAATAFIIKKSINTL--------------EIFAGAATPCFSFFA 316  Caenorhabditi...
Q6BES6        250 TSRNKTEIIILKQAFFIFLMFQIYNIIVLYGKTLKMTTVTAFYLKRAIHTA--------------EIFAGATTPCFVFFT 315  Caenorhabditi...
EGT32880      530 VSLVNTEKTLLKHSIFAFVIFQSPNCILLISQSFKMSNVSAFLIKRFVNTM--------------EIFGGAITPTFFFFT 595  Caenorhabditi...
O44177        234 STLSKNETLILKQAIFVFLIFQASSCVFLFAQSVQITNVGAFLVKRFVNTM--------------EILAGAATPSFFFFT 299  Caenorhabditi...
NP_507594     241 STLSKNETLFLKQAMFVFIIFQASSCVFLFAQSVQITNVGAFLVKRFVNTM--------------EILAGAATPSFFFLT 306  Caenorhabditi...
EGT32880      218 LSLKDHEKTILKQAIFTFVVFQAPSLVFMGANFFYIEELEAFLIKRFVNTM--------------EIFGGIATPSFFFFT 283  Caenorhabditi...
NP_506279     247 STLNKNEIRVLVQAIVIFVFFQASSSVFLICQTIAFNTATAFVIKRIINTL--------------EIFAGAATPCFSFFT 312  Caenorhabditi...
XP_003112400  319 SREIRKVVSSRIGSGS 334  Caenorhabditis remanei
CAO82042      320 SKEIKKMASVKSSMNN 335  Caenorhabditis elegans
EFP11074      353 SKDIRKLVTVKVSASS 368  Caenorhabditis remanei
CAP29162      317 SEKIRKMLSSKVPAIS 332  Caenorhabditis briggsae
Q6BES6        316 SKEIKKLVSNKITAGS 331  Caenorhabditis elegans
EGT32880      596 SREIRKIFASRVYATN 611  Caenorhabditis brenneri
O44177        300 SKEIRKLVSTRVSAVS 315  Caenorhabditis elegans
NP_507594     307 SKEIRKLISTKVSAVS 322  Caenorhabditis elegans
EGT32880      284 SQEVRKIMTSRVYATN 299  Caenorhabditis brenneri
NP_506279     313 SKEIRKLLSSKIAAVS 328  Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap