Conserved Protein Domain Family
DUF620

?
pfam04788: DUF620 
Protein of unknown function (DUF620)
Family of uncharacterized proteins.
Statistics
?
PSSM-Id: 398452
Aligned: 37 rows
Threshold Bit Score: 403.54
Threshold Setting Gi: 300154283
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AQK84813     130 MYAVGKVLMRTRSSstttkqgqKARRTGMVGVv-hGGAEIAGGLVLWQKGPEVWCVEMVVAGg-TKMSAGSDGRVAWRQT 207 Zea mays
ERN04458     115 MYVMGKVKMVMVQVecg--ansSYTLSSSLSGs-gGGVVEEGCFVIWQMAPEKWLMELDVGT--HKVVAGSDGKIAWRHT 189 Amborella trich...
Q9FG09       104 tFVTGKITMTMVSD-----------INSSTAVssaSSVSHKGCFVMWQMLPEKWLIELVGGG--HKVSAGSDGEITWRYT 170 thale cress
KRH38019     105 VFTTGKVTMDVVDE--------LGSAGGSV-------NLEKGCFVMWQMVPDKWQIELVLGG--QKVVAGSNGAIAWRHT 167 soybean
CBI29967      99 VFATGKVRMAMVDE--------LGSSGSSTAVg-pTGVSQKGCFVMWQMVPDKWLIELVVGG--HKVVAGSDGNVAWRHT 167 wine grape
EFJ12683     124 sYAAGKIRMSLSEFet-----vNRVVRTKNPFr-pA---EAGCFVLWQMKPDMWYVELVLGGgsSKVHAGCDGKLVWRQN 194 Selaginella moe...
XP_002890744 162 gYVMGRIRTMASEFet-----gSKGSKSKNNSs-kS--VESGGFVLWHMNPDMWYMELVLGG--SKVLAGCDGKLVWRHT 231 Arabidopsis lyr...
Q9C6D0       198 AYAMGKLKMITSELet-----pTGTVRNRNSTk-----sETGGFVLWQMNPDMWYVELSVGG--SKVRAGCNGKLVWRHT 265 thale cress
XP_014661243 188 AYAMGKVRMVASEFet-----aTRVVKNRGSGa-aASAVEQGGFVLWQMSPDMWYVELAVGG--SKVRAGCNGRLVWRHT 259 foxtail millet
XP_002464250 169 sYAMGKVRMVATEFet-----gGRLTKNRNAGr-gG---EPGRFVLWQMAPEMWYIELVVGG--SKVHAGCNGKLVWRHT 237 sorghum
AQK84813     208 PWQQAHASRGPPRPLRRCVQGLNPRSTANLFSTATWVGEKSVDGDDCFVLRVDADPLALRARSGDDVEVVRHAVWGYFSQ 287 Zea mays
ERN04458     190 PWLPSHAAKGGVRPLRRILQGLDPFTVASTFLGADYVGEKQISDEDCFMLKLAVDREALVERSDSAAEIIKHNLVGYMSQ 269 Amborella trich...
Q9FG09       171 PWLGDHAAKGAIRPLRRALQGLDPLTISSVFSSAQFVGEKEINGKDCFILKLSTDQIDLSKRSDSTAEMIKHVAFGYFSQ 250 thale cress
KRH38019     168 PWLGVHAAKGGVRPLRRALQGLDPLAVSSVFCAAQYMGEKEISGMDCFVLKLSAEQKDLVERSDSKAEMIKHAIFGYFSQ 247 soybean
CBI29967     168 PWIGAHAAKGGVRPLRRVLQGLDPLAVSAVFSSAQYMGEKRIMGVDCFVLKLSADHTDLADRSDNTAEMIKHVIFGYFSQ 247 wine grape
EFJ12683     195 PWMGPHAAKGPVRPLRRVLQGLDPLTTATIFSGAVCVGEKRLGGEDCFVLKLAADPYTLGARSDGPAEIIRHVLFGYFSQ 274 Selaginella moe...
XP_002890744 232 PWLGPHAAKGPVRPLRRALQGLDPRTTAYMFANARCIGEKKIDGEDCFILKLCADPATLKARSEGASETIRHTLFGYFSQ 311 Arabidopsis lyr...
Q9C6D0       266 PWLGSHTAKGPVRPLRRALQGLDPRTTATMFAESKCVGERKVNGEDCFILKLCTDPETLRARSEGPAEIVRHILFGYFSQ 345 thale cress
XP_014661243 260 PWLGAHAAKGPVRPLRRALQGLDPLSTARLFAEARCVGERKVAGEDCFILKLSADAETLRQRSEGPAEIIRHVLFGYFSQ 339 foxtail millet
XP_002464250 238 PWLGAHSATGPVRPLRRSLQGLDPLMTASMFARARCIGERKVNGEDCFILKLSTDTETLKARSEGHAEIIRHVTFGYFSQ 317 sorghum
AQK84813     288 RTGLLSRLEDSHLLRVR--ATkgsplaQTTTYWETSMDSSIGDYRAVDG--INVAHAGRTVVSLSRFggstnddsaGSES 363 Zea mays
ERN04458     270 RSGLLVHLEDSYLTRIQp-PG------SQATYWETTIASSIGDYRAIEG--IMVAHSGHSSVTITRF---------GDGV 331 Amborella trich...
Q9FG09       251 KSGLLICLEDSSLTRIQi-PG------TVPTYWETSMSSWMEDYRAIEGseVVIAHSGKTDVLISRF---------GETL 314 thale cress
KRH38019     248 RSGLLVYLGDSYLTRIQa-PG------SHPTYWETTMSTKIEDYRIVDG--VMIAHAGSSTTLITRF---------GDNL 309 soybean
CBI29967     248 RSGLLVYLEDSYLTRIQs-PG------SRPTYWETTMATKIEDYRTVEG--VMIAHGGQSSAIITRF---------GDNL 309 wine grape
EFJ12683     275 RTGLLVRIEDSHLTRIQa-SA------GEVVYWETSIESTLEDYRSVDG--LVIAHSGHSCVTLFRF---------GEVA 336 Selaginella moe...
XP_002890744 312 KTGLLVHLEDSQLTRIQn-NG------GEAVYWETTINSYLEDYKPVEG--IMIAHSGRSVATLLRF---------GDMS 373 Arabidopsis lyr...
Q9C6D0       346 RTGLLAQIEDSQLTRIQs-ND------GDAVYWETTINSSLDDYKQVEG--IMIAHSGRSVVTLFRF---------GEVA 407 thale cress
XP_014661243 340 RTGLLAQLEDSHLTRIQphAG------GDAVYWETTISSFLEDYRAVDG--VAIAHAGRSAVTLFRF---------GETA 402 foxtail millet
XP_002464250 318 RTGLLAHIEDSHLTRIQsaAG------GDAVYWETTISSFMEDYRPVDG--IMIAHSGRSAVTLFRF---------GEVA 380 sorghum
AQK84813     364 AgvLG-RRtcTCMEENWSIEEVDFNVVGLSAECFLPP 399 Zea mays
ERN04458     332 K--VG-GAt-TRMEEAWAIEDLVFNVPGLSVDCFIPP 364 Amborella trichopoda
Q9FG09       315 K--GG-ISv-TRMEEKWTIDDVAFDVPGLSVDCFIPP 347 thale cress
KRH38019     310 K--AG-PSi-TRLEESWTIDDVAFYVKGLSLDCFIPP 342 soybean
CBI29967     310 K--VG-PAi-TRMEETWTIDDLAFNVPGLSMDCFIPP 342 wine grape
EFJ12683     337 M--GH-TR--TRMEEDWTIEEVALNVPGLSEDCFIPP 368 Selaginella moellendorffii
XP_002890744 374 S--GHnTK--TTMQEAWVIDEIAFNVPGLSIDCFIPP 406 Arabidopsis lyrata subsp. lyrata
Q9C6D0       408 M--SH-TR--TKMEERWTIEEVAFNVPGLSLDCFIPP 439 thale cress
XP_014661243 403 M--SH-TK--TRMEEAWTIQEAAFNVPGLSTDCFIPP 434 foxtail millet
XP_002464250 381 M--SH-TK--TRMEEVWSIEEVAFNVPGLSMDCFIPP 412 sorghum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap