Conserved Protein Domain Family
Corona_NS2

?
pfam04753: Corona_NS2 
Coronavirus non-structural protein NS2
Statistics
?
PSSM-Id: 398429
Aligned: 9 rows
Threshold Bit Score: 172.691
Threshold Setting Gi: 744692658
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AFE48828                       1 MDVWRPEKKYLRYTNGFNVSELEDVCFKYNYQFPKVGYCRVPNYAWCRNQGSFCATFTLYGKSKRYDKYFGIITSFTAFA 80  Rabbit coronavirus HKU14...
jcvi:cva1.polypeptide.1407.1   1 MDIWKPEIKYLRYTNGFNVSELEDACFKFNYKFPKVGYCRVPSHAWCRNQGSFCATLTLYGKSKHYDKYFGVITGFTAFA 80  White-tailed deer coronavirus US/OH-WD470/1994...
Q8JSP6                         1 MDIWCPEKKYLRYTNGFNVSELEDVCFKYNYQFPKVGYCRVPNYAWCRNQGSFCATFTLYGKSKHYDNYFGIITGFTAFS 80  Porcine hemagglutinating encephalomyelitis virus (strain IAF-404)...
BAS18867                       1 MDIWRPERKFLRFTNGFNVPELEDVCFKFNYQLPKVGYCRVPNYAWCRNQGSFCATFTLYGKSKHYDKYFRIITGFTAFA 80  Equine coronavirus...
YP_009113027                   1 MDPWAVDN--IVYTRAFDVYNLESYCSIFGYKRPAVGYSFVHNNSWCRNQGKVLATLTLYGKT---DKNFGIISGFKSFG 75  Betacoronavirus HKU24...
Q0ZME6                         1 MEVWRPSYKYSLITREFGVTDLEDLCFKYNYCQPCVGYCIVPLNVWCRKFGKFASYFVLRSHDTSHKNNFGVITSFTSYG 80  Human coronavirus HKU1 (isolate N5)...
Q5MQC9                         1 MDVWRPSYTHSLVIREFGVTNLEDLCLKYNYCQPIVGYCIVPLNVWCRKFGKFASHFTLRSHDISHSNNFGVVTSFTTYG 80  Human coronavirus HKU1 (isolate N1)...
ACN89778                       6 TWIWHVSDAWLRRTRDFGVIRLEDFCFQFNYSQPRVGYCRVPLKAWCSNQGKFAAQFTLKSCEKPGHEKF--ITSFTAYG 83  Murine coronavirus repJHM/RA59...
Q9PY98                         1 MDIWHVSDAWLRRTRDFGVTRLEDFCFQFNYCQPRIGYCRVPLKAWCSNQGKFAAQFTLKSCEKSGQEIF--ITSFTAYD 78  Murine hepatitis virus strain 2...
AFE48828                      81 NTLEEAVNKLVFLAVDFITWRRQELNVYG 109 Rabbit coronavirus HKU14
jcvi:cva1.polypeptide.1407.1  81 NTVEEAVNKLVFLAVDFITWRRQELNVYG 109 White-tailed deer coronavirus US/OH-WD470/1994
Q8JSP6                        81 NSLEEAVNKLVFLAVDFITWRSQSLNVYG 109 Porcine hemagglutinating encephalomyelitis virus (...
BAS18867                      81 NTIEEAVNKLVLEAVDFIIWRSQNLNAYG 109 Equine coronavirus
YP_009113027                  76 NSPSEAVNKLVSETIEFILWRAEHLNRYG 104 Betacoronavirus HKU24
Q0ZME6                        81 NTVSEAVSKLVESASDFIAWRAEALNKYG 109 Human coronavirus HKU1 (isolate N5)
Q5MQC9                        81 NTVSEAVSRLVESASEFIVWRAEALNKYG 109 Human coronavirus HKU1 (isolate N1)
ACN89778                      84 RTVQQAVSKLVEEAVDFILFRATQLERNV 112 Murine coronavirus repJHM/RA59
Q9PY98                        79 KTVKKAVSKLVEEAVDFIIWRATQLERYV 107 Murine hepatitis virus strain 2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap