6CXH,1YEW


Conserved Protein Domain Family
Monooxygenase_B

?
pfam04744: Monooxygenase_B 
Click on image for an interactive view with Cn3D
Monooxygenase subunit B protein
Family of membrane associated monooxygenases (EC 1.13.12.-) which utilize O(2) to oxidize their substrate. Family members include both ammonia and methane monooxygenases involved in the oxidation of their respective substrates. These enzymes are multi-subunit complexes. This family represents the B subunit of the enzyme; the A subunit is thought to contain the active site..
Statistics
?
PSSM-Id: 398424
Aligned: 14 rows
Threshold Bit Score: 485.686
Threshold Setting Gi: 503977361
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6CXH_A        34 GEKSQAAFMRMRTIHWFDLNWS---KDQVSVNETMSISGKFHVFAGWP-ETVDKPEVAFLNIGIPGPVFIRAGSWIGGQL 109 Methylomicrobiu...
EIC29218      30 GEKALEPFIRMRTIQWYDVAWS---KQQFKVNEEVTVSGRFHVAEDWP-VSVPKPDAAFLNVSTPGPVLIRTERWLNGKP 105 Methylomicrobiu...
Q04508        39 GERSQEPFLRMRTVQWYDIKWG---PEVTKVNENAKITGKFHLAEDWP-RAAAQPDFSFFNVGSPSPVFVRLSTKINGHP 114 Nitrosomonas eu...
Q2Y6K6        33 GERSQEPFLRMRTIQWYDMKWG---PETTKVNDIATMTGKFHLAEDWP-RAVGKPGRAFFNVGSPSPVFVRLSTKLNGEP 108 Nitrosospira mu...
WP_014211355  45 GEEGQQAFEKTATVTFYDVRFS---TTELDIGQELTITGTLRVMESWPdHTLAAPELGYLSINQPGPRFYVTERWMSDTF 121 Mycolicibacteri...
WP_012463842  40 GAKSQEAFLRMRTVTFFDTRFSftpGNRVKVGDEFTCTGKVMLMPTWP-QEIPFSGISFFNFFVPGPQVLRKAIFVNEKY 118 Methylacidiphil...
MA:Minf_1589  35 GERAQEAILRMRTAQFYDVRFS---TNHLKVGEDLVVTGKVMILPIWP-HELGFSGIGYINFFEPGPRLVRKETVVNGQP 110 Methylacidiphil...
Q6MZ16        44 GERSQQAFLRMRTLNWYDVKWS---KTELNVNDEMELTGKVHVFSGWP-QAVARPGESFLNVGEPGPVLIRKSAFVGEVP 119 Methylocystis s...
Q3J892        16 GEKAQAAFLRMRTIHWYDMVWS---KDTIAVNETYTISGKFRVFEDWP-EAVEKPHVSFLNAGQPGPVTARLTSYVNGMF 91  Nitrosococcus o...
Q70EF2        30 GEKSQQAFLRMRTLNWYDVQWS---KTTVNVNEEMVLSGKIHVFSAWP-QAVANPRVSFLNAGEPGPVLVRTAQFIGEQF 105 Methylocystis s...
6CXH_A       110 V-PRSVSLELGETYEFKVLLKARRPGDWHVHTMMNVQGGGPIIGPGKWVTITGSMGDFKNPITTLTGETIDLETYALDGV 188 Methylomicrobiu...
EIC29218     106 W-VNSVALQPGGDYEFKIVLKGRLPGRYHIHPFFNLKDAGQVMGPGAWLDISGNAGDFSNEVRTLNGEIVDMESVGLFNG 184 Methylomicrobiu...
Q04508       115 W-FISGPLQIGRDYEFEVNLRARIPGRHHMHAMLNVKDAGPIAGPGAWMNITGSWDDFTNPLKLLTGETIDSETFNLSNG 193 Nitrosomonas eu...
Q2Y6K6       109 T-YISGPMEIGRDYAFEVRLKARIPGRHHMHAMVNIKDAGPIAGPAAWMNISGSWDDFTNPVKLLTGETIDTETFNFSNG 187 Nitrosospira mu...
WP_014211355 122 T-PQSVKIHKGATYPFKIVAKARIPGTYHIHPTFAVHDAGTLVGPGQWVTIA-DAGEFSVPMELATGETVEMGGFGIGNV 199 Mycolicibacteri...
WP_012463842 119 FqFNSVVLEKGGVYEYKMVNQARYPGIWPVGPMLSMEEAGPFIGPEEYLTIEGSYSGFTNPVKTLLGNTIDLENYGEARM 198 Methylacidiphil...
MA:Minf_1589 111 L-FSSMIIKLGDNYEFKEVLTARQPGNWPVGVTMNIKDIGPIVGPSIKVAIDPSNSPFTYIIKTLTGQTVNLENYGLSRA 189 Methylacidiphil...
Q6MZ16       120 V-PRTFSMDVGNDYEYKIVLKARRQGRYHVHVQINVKDGGPIVGPGQWITIKGDMKDFTNPVTLLEGSTIDLETYGITWT 198 Methylocystis s...
Q3J892        92 V-PRSIGLELGGDYEFEMTMQGRRPGTWHVHTLLNVQGGGPLIGPGKYITITGDMADFESKITDLTGNTVNLETMATGTV 170 Nitrosococcus o...
Q70EF2       106 A-PRSVSLVPGNDYAFSINLRGRRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMKDFTDPVTLLDGSTVDLETYGISRV 184 Methylocystis s...
6CXH_A       189 YGWHLFWYLLGVAWMVYWCRKPVFIPRRIAVDAGKADSLITPTDKKVGMAFAAGTLAIVAVSMGQANEKYPVTTPLQAGl 268 Methylomicrobiu...
EIC29218     185 IGWHLFWGVLATAWLLWWVRRPLFISRYRMLQAGMEDELITVNDRLIAKVVLAAVPVAVLAINAVTVNRYPNAIPLQAS- 263 Methylomicrobiu...
Q04508       194 IFWHVVWMSIGIFWIGVFTARPMFLPRSRVLLAYGDDLLMDPMDKKITWVLAILTLALVWGGYRYTENKHPYTVPIQAG- 272 Nitrosomonas eu...
Q2Y6K6       188 IFWHILWLSLGIFWIGYYVARPMFLPRSRVLLAYGDELLLDPMDRKVAWVVLILTFGIVWGGYRYTETKHPYTVPIQAG- 266 Nitrosospira mu...
WP_014211355 200 VAWTAISFVIAAGYLAFWMRKG-LLWRAFPVAEGRGASIISKGQVKVSVAIAVLALLVGVGSYAYAEVTTGPKVPPQ--- 275 Mycolicibacteri...
WP_012463842 199 IMWTLLTSAVAVAWLVYWCSKP-FTRRLGLVAAGRKEDLFSPMDRQVCFLFTIGTIVLVAAAAMITKAQYPITIPIQET- 276 Methylacidiphil...
MA:Minf_1589 190 FGWSMLWVFLGIGWLYYWLILKPTAPRLGLAYLEKEEELITKKDTQFGLLFLAIVVILVFGGAFITSKQFPIVVPLQKT- 268 Methylacidiphil...
Q6MZ16       199 YIYHFFWMAAAAAWILYWFMTKGIIVRYWQVKAGKGRELIGQDEKRIGAVTLAAVLLAVLVFYASANREFPRTLPMQAGl 278 Methylocystis s...
Q3J892       171 IGWHLFWYVLGIAWIWWWARRPMFLPRYMRIEAGEANDLVTAQDKKLTIGVLVGVLLIILFGFKSAEDKFPVTIPLQAGl 250 Nitrosococcus o...
Q70EF2       185 YAWHLPWLAVGAAWILFWFVRKGIIASYLRVATGKVDEQVTDDDKRIGAIVLALTILATIVGYAVTNSTFPRTIPLQAGl 264 Methylocystis s...
6CXH_A       269 MRGIKSLELP------QPTVSVKVVDASYRVPGRAMQMTLEITNNGDSAVRLAEFNTASVRFLDADVye--ddTNYPDDL 340 Methylomicrobiu...
EIC29218     264 LDQVLPLSAQv----nAGQVDAEAVKAEYIIAKRMMIFTVRVNNRSDKPVQLGEFNTANVSFINPEL------PAASQVS 333 Methylomicrobiu...
Q04508       273 QSKVAALPVA------PNPVSIVITDANYDVPGRALRVTMEVTNNGDIPVTFGEFTTAGIRFINSTGrky-ldPQYPREL 345 Nitrosomonas eu...
Q2Y6K6       267 ESKVEPLPVK------PNPIAIKVTHANYDVPGRALRVTMSVTNSGDKPYRIGEFTTAGVRFINKVGlkh-ldRGYPKEL 339 Nitrosospira mu...
WP_014211355 276 VARVEPAAAVad--plGKQLKVHVDSAVFQTGTGRLEFKLTVTNNSPEPVLLQKLQFSTYQAINRDVaa---gSAAPD-- 348 Mycolicibacteri...
WP_012463842 277 KYYIKPLPPE------PSIIQAEVTDATYDVPGRTLSFHIQVKNVGDKPVVLKEFLTANVRFLNPDVpgntwnENYPE-- 348 Methylacidiphil...
MA:Minf_1589 269 FVRIDPLAPE------PAFVEAKVTKATYNVQQRSLDFDLQVTNKGTDKVYLKRFQTANVAFLNPSApnnqwaSDSPE-- 340 Methylacidiphil...
Q6MZ16       279 LTGISPIDEP------RSTVAVQFKGGSYTVPGRELRIRAKVTNNGKEPIRLGEFTSAGLRFLNPDVft--trPDFPDYL 350 Methylocystis s...
Q3J892       251 LGTIDSLPVDy-----NSMVSANVLKANYRVPGRTISMTVEITNHTDQVISIGEFNTGGIRFMNANVrv--deTDYPEEL 323 Nitrosococcus o...
Q70EF2       265 QKPLTPLVTDgtagvgKERVTSELNGGVYKVPGRELTINVKVTNSTSEPLRLGEYTAAGLRFLNPDVft--tkPDFPDYL 342 Methylocystis s...
6CXH_A       341 LAEEGLSvSDNSPLAPGETRTVDVTASDAAWEVYRLADLIYDPDSRFAGLLFFIDED-GNRQMTMVDAP-LIPTF 413 Methylomicrobium alc...
EIC29218     334 TIEATLRlDDNTPIRPGEERTISVTAQDALWETEKLDGLINDADSRVGGLLFLYDSEsGERYISSVSAA-VIPKF 407 Methylomicrobium alb...
Q04508       346 IA-VGLNfDDESAIQPGQTKELKMEAKDALWEIQRLMALLGDPESRFGGLLMSWDAE-GNRHINSIAGP-VIPVF 417 Nitrosomonas europae...
Q2Y6K6       340 VA-TGLSfDNETPIQPGETREVKMEAKDALWEVQRLMALLGDPESRFGGLLMTWSED-GDRNINSIAGA-VIPVF 411 Nitrosospira multifo...
WP_014211355 349 -PGELVAvTPPGQIQPGETRTLTVDLDGAALAQQGLLPL-NEAQVRITGLIFFTDAS-GQSAISEVNelttgilp 420 Mycolicibacterium rh...
WP_012463842 349 VNGGAVIvKPSEPINPGETKTLEVSMQSAEWENQRLT-LYHESTNRFGGLLFFSDTS-GTRQVYAIADQiVIPKF 421 Methylacidiphilum in...
MA:Minf_1589 341 VNGGELQiTPSEPILAGETKTLHVKAQGSAWEVERLSTIYKETASRFGGLLFFSDTE-GRRNIIAIADQfVVPVF 414 Methylacidiphilum in...
Q6MZ16       351 LADRGLSvSDPNPIAPGETRDLEVIVQDARFDIERLSDLAYDTDSQFGGLLFFFSPS-GERQRAEIGGP-VIPKF 423 Methylocystis sp. SC2
Q3J892       324 LAPEGLEvSQQD-IAPGETVVVDISATDAAWEVQRMADVIYDPDSRFAGLIFFVDPE-GNEIPIPIGGP-LVPTF 395 Nitrosococcus oceani...
Q70EF2       343 LADRGLS-TDPTPIAPGETKEIAVKVQDARWDIERLSDLAYDTDSQIGGLLMFFSPT-GRRFAAEIGGP-VIPKF 414 Methylocystis sp. SC2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap