Conserved Protein Domain Family
LXG

?
pfam04740: LXG 
LXG domain of WXG superfamily
This domain is present is the N-terminal region of a group of polymorphic toxin proteins in bacteria. It is predicted to use Type VII secretion pathway to mediate export of bacterial toxins.
Statistics
?
PSSM-Id: 398423
Aligned: 38 rows
Threshold Bit Score: 122.752
Threshold Setting Gi: 558690768
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ADC50601    2 KILDAASMIENVESLLQEVKRQQDQLSPVESWLHNeaaLLGVES-RFNGRTAIRIINYFTY---CHGPFVKLLRTILSEF 77   Bacillus pseudofi...
P96722      3 KVFESKSLIEEAKSRKKQYETLEEQLNTLKKAFQG---VADLGD-NFKGNGADNIKDFFQG----QAEIVDSWLTLVSAQ 74   Bacillus subtilis...
Q65H85      2 KVFEAHSLIEAANNRKKQYETFEDQLQTLKKAFLG---VADLGD-DFQGKGADNIKDFYKG----QAEIVDSWLKLVEAQ 73   Bacillus lichenif...
CCO09564    3 K-MDIGEYKHLLSQMKELKLTLGLSFTGTNGTIEE-----FSGDtKLKGVAWSSTKSYFSA---GYTPMLDGLSDVFYTA 73   Carnobacterium ma...
Q8YAN8      2 SRIDIGEIQAFLYQLRATNEPGRKTIQSIKAAVTK-----YVGDnSLKGKAVDASKNYYQM---TYFPLCDAIIEAMDES 73   Listeria monocyto...
Q8YA28      2 SRIDIAELNDFLHGLRSSNAEAKAMIRKIKEAAMD-----YAQDnRLKGEAVSTSKQYFSS---TYTSICQSIIEALDES 73   Listeria monocyto...
EIM56723   11 A--------AQCESMIEAFRSEKDKLDGVNRSVDN-----FSQDsALQGKAWSALKQQMSDyalLSEGLLEANRSMIAD- 76   [Eubacterium] cel...
Q8ERI3      4 K-VDISEVIELSEDVNSSTADIKTSLNSISESIDR---LNSLE--SFSGKTATNAKNYFND---LHKTILVTFEHLFTDL 74   Oceanobacillus ih...
CDC23087    3 yhvkIEELLEVQNQIISQLSEWGTQLETVYQALET---IVVTP--CIQGETGKSIQNYIQE---VHIPVIGSLQQLLTEF 74   Clostridium nexil...
CCZ26007    5 ykimyssMDQFYDQTNGRMAEWVSQLEPWVKACEN---LGNME--CYQGKSAESVKTYLKE---VHMTLLTSIQQAIQLY 76   [Ruminococcus] to...
ADC50601   78 EASLEDTLNQLNA--YFNQNEYIREDFLQDEVNGKIEELKSTMTTLGEEVNS-IIAMYKDVVYLPEFNYNRVMDGLATLK 154  Bacillus pseudofi...
P96722     75 IAFLNGISGDIKDq-ELN-DSYVETSFLDHELPNGDLKASEIVSAHKEEIDS-ILSGISDIIDLDMYTLDDYADKMGDAQ 151  Bacillus subtilis...
Q65H85     74 IAFFNGVSGDIKDk-KLS-DSYVEVSFLDHELKNADLKATEIVSGLKLEMDK-IIASISDIVDLDNWTLDDYIDKMSKAQ 150  Bacillus lichenif...
CCO09564   74 ITTLENFIRAFESe-VTASGVKLDLDHLQ-DLQRRRDELQREKTNWLHQIAE----QASKIPGLGHLFDDY---SVLQAE 144  Carnobacterium ma...
Q8YAN8     74 EERLGQYIQDFHAevDSSPDAKIDADGLY-ELGKMIDRIESKKEALAQRMNS---GTEGQM--------QNYRSQLAIAY 141  Listeria monocyto...
Q8YA28     74 EERLAQYIREFGSqvDSSPSARIDAEILQ-EAMAKVSQLQRKEEDLHRQLTA--PNTKPDMQQVYAVKSRSVHTQLLKAI 150  Listeria monocyto...
EIM56723   77 CQSLSDAVASIED--DPQDEDKLESSIHKLNAANRILQFCKSIAEGAQGIGGgVSPTTSQAVWNTIETYQSMIEDNNRSI 154  [Eubacterium] cel...
Q8ERI3     75 DDSLKKHLEMFQSrvDTSESAIIVSDYVK-DLELDIKEDWEKLSLEQDKVRE-TMNSVSDI-------TSAIHPNYYPPE 145  Oceanobacillus ih...
CDC23087   75 QVRLSVYAEGYYGi-DSSYEAEIPQEILE-EQQQVLENGREDFENLREEINS-VISSVSDIVSVVQPSGLALVLSYQLME 151  Clostridium nexil...
CCZ26007   77 RTKYLFYREGYYDi-EGDLYAVIPQKTLL-SVKDRMKTEIEDVSDSSLIVQT-SLLNVSDLIALQAPNSYYLKDSMEEVK 153  [Ruminococcus] to...
ADC50601  155 SKSKETDEKMYQYDYEQIPSMEFVGQDIQLLQNYVSSLEEMFVSQSISIEQ 205  Bacillus pseudofirmus OF4
P96722    152 KIRRDTITAVDKLDESLTTEYQNLESLDNAVLTKYSVLMQATSNGKSASPM 202  Bacillus subtilis subsp. subtilis str. 168
Q65H85    151 TTRQNTIDAVNKLDESLKTEYTNLQALDSAVLGKYSGLMEATSHGKTASPM 201  Bacillus licheniformis DSM 13 = ATCC 14580
CCO09564  145 KKVQ-LMEDFRDFIHRHDSDFSELNGLIEQVLLGLEELGKQRSFNGDKQGY 194  Carnobacterium maltaromaticum LMA28
Q8YAN8    142 KQ-ENILEKYLSFEQSHANFFDHLIDLVQAVQQTIRELQSNIQFNSQTGTY 191  Listeria monocytogenes
Q8YA28    151 EQ-ENILEKYLAFEQSHGQFFSALDELIRATARAVQELLHHVSFNDKTGTY 200  Listeria monocytogenes
EIM56723  155 EKMQEKIRQLQTAETQTNYLFLDADMIFKVVNWGYQSVRGAWSNGSyhpde 205  [Eubacterium] cellulosolvens 6
Q8ERI3    146 ADKDDVIKIITNLEQELNSFTSVGQEEISSIEDLLNQVATTIENAGTVEGK 196  Oceanobacillus iheyensis
CDC23087  152 SRVKTLNSDIGDYEETHQNDTQNMNSMLESIRSI---LIARTGSPAISVTN 199  Clostridium nexile CAG:348
CCZ26007  154 QNVTDFNQNIIDYEAQHKSEANGELADL--LQSLFATLTEYYTNGTNVTSY 202  [Ruminococcus] torques CAG:61
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap