Conserved Protein Domain Family
Radial_spoke

?
pfam04712: Radial_spoke 
Radial spokehead-like protein
This family includes the radial spoke head proteins RSP4 and RSP6 from Chlamydomonas reinhardtii, and several eukaryotic homologs, including mammalian RSHL1, the protein product of a familial ciliary dyskinesia candidate gene.
Statistics
?
PSSM-Id: 398404
Aligned: 39 rows
Threshold Bit Score: 370.451
Threshold Setting Gi: 284089593
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9W1D3               83 ELNVAKSILQKYSTLSGDNLFDHLSDIIKRVIDERPPNVI---DFFEEFSRNVREQKF---------HLPERFPPSGVFD 150 fruit fly
WGS:AAQB:GK21932-PA  90 ELNVAKSIMQQYSTLSGDNLFDHISDIIKRVIDERPPNVI---DFFEEFSRNVREQKF---------HLPERFPPQGVFD 157 Drosophi...
XP_002005830         89 ELSVAKSILQQYSTLSGDNLFDHLSDIVKRVVDERPPNVI---DFFEEFSRNVREQKF---------HVPERFPPNAVFA 156 Drosophi...
EDW01951             90 ELNIAKSILKQYSTLSGDNLFDHISDIVKRVVDERPPNVI---DFFEEFSRNVREQKF---------HVPERFPPNGVFA 157 Drosophi...
4_pfamImport          1 DFQLAKRYLQK-YGEENETLWGLLVEVIHRIMVAEKEITP---KELHLLCRRLRERKLhv-----edWLIDLYQEKLFYK 71 
EFC43249              9 lFEDAKAYLQT-TNENGKSIYDMLIDIVSYLQDHKDAKEI----NLKKLVEQLSEDGFkygersgfdELWKLSKPNPESC 83  Naegleri...
Q4DE57               13 MFGRTKAYLMN-ANKDGVSVYDQLTRLMEQLLDENPHDIAadpSRFNEIFTLLQQSSFvng---qstPACNEPCSVPPFE 88  Trypanos...
EAX89949              4 DREAKLEYLNTKPEGSPVSVMEHTGEVIIRLADNCAERPL---DYFEVASYIIKEERQskenqellkFGKPKGPNFVENA 80  Trichomo...
CAM69627            109 avHRAMAGIDE-HQIRQSALWGHMTQALAQVIRERPADAM---DALGAASNQLLSGSAvppm--kgnMYADPRPTARAAA 182 Leishman...
Q4DHQ3               42 csfIAMTGLTE-NEIRESPLWQHMKKVLLQVVQQQPSSAL---DAIIPSSFVVQTGSAvpph--attIYADHRPRVTNAV 115 Trypanos...
Q9W1D3              151 EVRSFRVakKILQSMKLPYVVegedlm-gedlsvEDLRTNEDmrividd----smryfvTFNERVQQLQFYWTQCGFSIS 225 fruit fly
WGS:AAQB:GK21932-PA 158 ESRMFRIakTILQSMKLPYNIetedfgiqedvsaED-KTNVDddfrivid--dsirhfvTFNERVQQLQFFWNQCGFSIS 234 Drosophi...
XP_002005830        157 DCRMFRPakRILHSIKLPHNAegsdlg-gdedfgEEAYTYADgelqidld--dsmrlfvSFNERVEQLQFFWNQCGFTIS 233 Drosophi...
EDW01951            158 DCRMFRPakQILHSIKLPHSGenldfegdedlggEE----FEaelrinid--dsmrmfvTFNERVEQLQFYWNQCGFSIS 231 Drosophi...
4_pfamImport         72 SSIELID--LYTKPKYKWNWEdkap------------------------------dpvkTLDEHFFVKMRMKRNIGVCLP 119
EFC43249             84 NKAREIVevLSKQQNVMKEEFskrkkaieelnvkKDGDDDNQddpveenpdimylysneDGVSNLIEDFYALELVGVGLP 163 Naegleri...
Q4DE57               89 LARLADNerLFDRPPP------------------ETLTTIEQpdpyttvtttrikphtaPPYDSVAQHNLYWAWAGCGVT 150 Trypanos...
EAX89949             81 KTNVRLQaqLFPKQQLGEEEEeageaeggedaehQEEETVNE-----------------GEIPNVIGNMQFMNEVGVGLN 143 Trichomo...
CAM69627            183 PVDSFTNtrWAANTNTALAPPrpprrprradaedEQEEEDASadagadgqpqvdladhpGALSDVVTEQQYFNMVGLGLP 262 Leishman...
Q4DHQ3              116 PSDALENlrWASSFGNVLAPPkprrkpteedeemPQEEAEENeee-----------vllGEVSNVVGEQAIFNSVGEGLQ 184 Trypanos...
Q9W1D3              226 NDDIFQLASAMNRLQTHPSIMQCRFWGCINGLKASYYIVEASLT--------------REEIASRLVMMEEEmrqkqipf 291 fruit fly
WGS:AAQB:GK21932-PA 235 NDDTFQLACAMNRLQTHPSIMQCRFWGCINGLKASYYIVEASLT--------------REEIASRLVMMEEEmrekqlpl 300 Drosophi...
XP_002005830        234 KDDIFQLAGSINRLQTHPSIMQCRFWGCINGLKASYYIVEASLT--------------REEISSRLTMMEEEmrekqlpf 299 Drosophi...
EDW01951            232 KDDIFQLASSINRLQTHPSIMQCRFWGCISGLKASYYIVEASLS--------------REEIASRLTMMKEEmrekqlpf 297 Drosophi...
4_pfamImport        120 EKEIYSIMMAMRVLADEVIVAKATFWGKIFGILRDYYIVESMAKklgrtigeigedvlLGEMPGEAAAE----------- 188
EFC43249            164 HEEIAKLSVAIQNLKSSKSLRYLRFVGKILGIESHYYVVESNYY--------------FKE------------------- 210 Naegleri...
Q4DE57              151 EEEAFLLDRSITMLAMEKKLRDVRFFGKIFGTKADYYVVSSQRYv------------qDGEKVYKEVNT----------- 207 Trypanos...
EAX89949            144 ETETILLQQAIQKLIRSKPLATARFWGKVMGIQNDYYIAEAEFN--------------DGERPHAAQEE----------- 198 Trichomo...
CAM69627            263 RVDAYRLLVGLRQLIRSEPLSTVRFWGVVTGSAYDYYVAECQVD--------------EDRMQENAGITGEG-------- 320 Leishman...
Q4DHQ3              185 PEEAFRLVVGMKQLVKTEPLATARFWGKILGSGADYYIVETKID--------------PERLPEDEEDV----------- 239 Trypanos...
Q9W1D3              292 pmRKDREDkpppahigpeltpgiyGWEEFPPEELEk----MKPKAAPVP----------------LVeemElydIPPEFI 351 fruit fly
WGS:AAQB:GK21932-PA 301 kmQKNREEkpapphigpeltpgiyGWDNYSPEELVh----MKPKAAAVP----------------LVqemEfydIPPEYI 360 Drosophi...
XP_002005830        300 kmRKNQEPnplpshigpeltpgvyGWENFSPEDLEk----MTPKAPPVP----------------LAeeiEfydIPPELV 359 Drosophi...
EDW01951            298 kvRKNQEAkpapahigpeltpgtyGWELYAKDELEk----MTPKAKPVP----------------LAeeiEvydIPPEYI 357 Drosophi...
4_pfamImport        189 ------------------------KKAEEPKEPVEevpppTVPPSTPKPeslfnkyvlpklpeskPRikiE---VPSEPY 241
EFC43249            211 ----------------------------------------KVPQDK----------------------------IHESGG 222 Naegleri...
Q4DE57              208 -----------------------------------------MPRPARRK---------------------LevpVQPEPG 225 Trypanos...
EAX89949            199 ------------------------EEKNEPEEGTEnk--eDKPRI-----------------------------VPKEE- 222 Trichomo...
CAM69627            321 ------------------------DAEDDMEEEEE-----HAPVSQIADvlctlaggrlarrwprPS-------APAEEA 364 Leishman...
Q4DHQ3              240 ------------------------GMADDEEEE-------GTPIDNVADvlysyg-------------akkqadTEVEPA 275 Trypanos...
Q9W1D3              352 GKGCNRYSYFVV-NSLF-DDWIELPIVTPRQIVVSRQIKKFLTGDLEADVISYPC--FPGKEKHYLRTLIGRITAGTYIA 427 fruit fly
WGS:AAQB:GK21932-PA 361 GLGCNRFSYFVV-NSLY-DDWIELPIVTPRQIVVSRQIKKFFTGDLEADVISYPC--FPGKEKHYLRAMIARITAGTYIA 436 Drosophi...
XP_002005830        360 GLGCNRYSYFVV-NNLY-DDWIELPIVTPRQIVVSRQIKKFFTGDLESDIVSYPC--FPGKEKHYLRAIIARITASTHIA 435 Drosophi...
EDW01951            358 GNGCNRFSYFVV-NCLH-NDWIELPIVTPRQIVVSRQIKKFFTGDLEADVVSYPC--FPGKEKHYLRAVIGRITAGTYIA 433 Drosophi...
4_pfamImport        242 GEGLNNKEYYVC-NLPG-EPWIKLPDVTPNQIAVARRITKFFTGDLEADVISMPL--FPGKEKNYLRATIARISASTQVA 317
EFC43249            223 KAGLNRFTYWVLrSKDSlTNFVNLPDVTPQQINAARNISKLFTGNLEKEIISYPP--FPGNEANYLRAQIARIVHSTTIA 300 Naegleri...
Q4DE57              226 FVGVNRLSFWVT-SHPA-AEWKLLPDVTPQQILAGRRIKRLFTGDLNAAVIASPP--FEWNEAVYLRVQLSRIASGTYIS 301 Trypanos...
EAX89949            223 DSGPNQYSYFVC-TQLG-GPWKLLPDITPAQIQGSRCIRQMFSGTEKGPIAA-PEgrFQGGEYELLRCFISRVTHSCTLA 299 Trichomo...
CAM69627            365 GTGLNAMCYYAS-TSADpTTWTRLPDVSPHHITVARALRCRFTGNLDAPVHGHPR--FMGCEKHYLRAQIARITSACRIA 441 Leishman...
Q4DHQ3              276 GSGLNEWVYYAA-QTADpTSWTRLPDVTPNQVIVARHIRRGFTGDLESSVDTHPH--FPGKEMNYLRAQIARISCACRVA 352 Trypanos...
Q9W1D3              428 PVGYYRrmtkkeqrmFdgeeeeegeeEEEEEEEEEFNEgeeeq-------iednDVMLLKNEKYEAE--PLG-------- 490 fruit fly
WGS:AAQB:GK21932-PA 437 PQGYYRrmtkrekrlFegg----evdEEEEEEEEEDFEgeedt-------lddnDVMLLKNERYEME--PLG-------- 495 Drosophi...
XP_002005830        436 PQGYYRrmtkkekdlFdgvn--fddeEEEQEEEDNYNEgeedt-------iqdnDVMLLKNERFEIE--PLA-------- 496 Drosophi...
EDW01951            434 PQGYYRrmtkkeknlYdginl-nqeeEEEEEEEDDFNEgkeee-------sqdnDIQLMRNERFEIE--PLS-------- 495 Drosophi...
4_pfamImport        318 PVGYYSg-------------------GGEEEDYEEAGEgg------------geGGEAELNSEFTGV--NWA-------- 356
EFC43249            301 PFDLFEere--------------vteANDEDDDDSNEKkkkneikykevlpppvKTKAFELKDPEGM------------- 353 Naegleri...
Q4DE57              302 PMGALEe------------------pEEEVDEEEEAEDde------------gdAAKKPREAKYRPLtqPVK-------- 343 Trypanos...
EAX89949            300 PKGLYNl-------------------EEEPEEGGRVENv--------------tPIAMAEEPEYKPL------------- 333 Trichomo...
CAM69627            442 PVQTFTteg--------------avpDAEEDEEETSARppptavpayavlppllPQEAPDEEDAEAIa-AVQawykgytk 506 Leishman...
Q4DHQ3              353 PRDMYTseg--------------avpEEEDEEGNVLpppesvka--yttlppltPQEVPDEEDTEAIe-PIKswfygyrd 415 Trypanos...
Q9W1D3              491 -SLAT---------P--VAWVHVRSNILNqQGRVVWYDEEKArkerekalalylkmqmlgeMEEEVEEEEDEEEg----- 553 fruit fly
WGS:AAQB:GK21932-PA 496 -SLET---------P--IAWVHVRSNILN-QGRVVWFDEEKAqkerekalahylkmrlmeeMEEEIEEEEAED------- 555 Drosophi...
XP_002005830        497 -TLAT---------P--VAWVHCRPNILN-QGRIVWYDEEKArkerekalamylkmrlmeeMDEEVEEEEADG------- 556 Drosophi...
EDW01951            496 -TLAT---------P--AAWVHVRSNILN-QGRVVWYDEELAdkerkkalamylkmraleeMGEELEEEEDAEE------ 556 Drosophi...
4_pfamImport        357 -KLYD---------KsqAFWAHYHPYVLP-QGRLKWWRPPFI-------------------KSDDVGDRGEGGE------ 400
EFC43249            354 --------------KslEHWVHLYPGILK-SGFITKEP------------------------LPGDQEPADPEDdkdpev 394 Naegleri...
Q4DE57              344 -GFASeedsdvtqwAklDQWVHSEGYIYA-NGRQTKVP------------------------EKQEDEEEEEAEelqqqq 397 Trypanos...
EAX89949            334 --------------EglKSFVHCVPTILD-QGRCEFYI------------------------FEEDQQDEEGNEk----- 369 Trichomo...
CAM69627            507 gELMQa-----------KGWSHIAPSVLN-CGRVTTA-------------------------PVEEEEEPADDEgddgqg 549 Leishman...
Q4DHQ3              416 dELLQg-----------KYWVHIAPTLLQ-TGRTV---------------------------AREQEEEDTGFD------ 450 Trypanos...
Q9W1D3              554 -----EEEGEEEgmiegfnQP--ELGPSILSSCAND----M--------------------------------NPEVPVS 590 fruit fly
WGS:AAQB:GK21932-PA 556 -----EEEGDEEgildhfiQP--ETGPSILSSCGSD----T--------------------------------KDEVRQP 592 Drosophi...
XP_002005830        557 -----EEEGEEEemiegfnQP--ETGPDILTSCASD----M--------------------------------SPDCVVP 593 Drosophi...
EDW01951            557 -----EEDGEEEdmlegfiHP--ETGPNILSSCAGD----M--------------------------------SNVCSIP 593 Drosophi...
4_pfamImport        401 -----LDEVDVK-------KP--ERGPPILRTITRD-------------------------------------KSEDVKP 429
EFC43249            395 psfklLQEDDGL-------KKckEAGASPKKKSEDD-------------------------------------DNDDDGE 430 Naegleri...
Q4DE57              398 qqeeeEEEEEEE-------EE--EEERELFTPINLDflyaVinipeppkvdeedeeeeeedddpaedaadaekDFDDMPP 468 Trypanos...
EAX89949            370 -------------------EPvvEHGPPILTPITED----K--------------------------------SKDEYKC 394 Trichomo...
CAM69627            550 dganaSEASPPP-------AP--EMIAPFLSDISLDaplsYpg-----------------------------hSRSHLAP 591 Leishman...
Q4DHQ3              451 -------------------HS--EKIHPFLCEVSRDdpltYas-----------------------------hSRSQLPA 480 Trypanos...
Q9W1D3              591 --------------------WLARMTS----KYTnQKERMLVMQSNVWPGAYTFI---FE---Kt------CESIYLGWG 634 fruit fly
WGS:AAQB:GK21932-PA 593 --------------------WLVRLTS----KYTnQKERMLVMQSNVWPGAFTFI---FE---Qt------CESIYLGWG 636 Drosophi...
XP_002005830        594 --------------------WLVRFTS----RYTnQKERVLVMQSNIWPGAFTFI---FE---Kt------CESIYLGWG 637 Drosophi...
EDW01951            594 --------------------WGVRFTS----KHTnQKERILIMQSNIWPGAFTFI---FE---Nt------CESIYMGWG 637 Drosophi...
4_pfamImport        430 --------------------WTLKTST----VIL-KKGIAVSARSNLWPGATSTA---LE---Vn------FQYIYIGWG 472
EFC43249            431 nkea------------klscWKVSFSNvrkqTCHhKSFKVVMLSSLRWQGAHTFY--------RnigpichFGNVYIGYG 490 Naegleri...
Q4DE57              469 kpvtdadvpdddptkvkiaaWTVRVVN----NNS-KKHRVVVVRSLRWPGAVAFA---AEg-gKk------WGCVYFGNG 533 Trypanos...
EAX89949            395 --------------------WSLREVN----GVS-KRY---WLRSNVWPGLHIVS---NEngsR-------MVMMYFGTG 436 Trichomo...
CAM69627            592 --------------------WTFRKAY----EGEgSLTAVYVAKSLRWPGAATYAvttAGrpgAs------YQMMYYGTG 641 Leishman...
Q4DHQ3              481 --------------------WSFRKAF----HNEsSKTRTYVARSATWPGAFTYAvveLGqpgSq------YQSVYIGTG 530 Trypanos...
Q9W1D3              635 HK-YYARNIPF-----KHLPMVQEEFPhNPEDFVEANDPTVEEEEAYKAWLL 680 fruit fly
WGS:AAQB:GK21932-PA 637 HK-YVARNMPF-----KHLPPVQEEFIhGPEDFIEASDPSVEEEAAYREWLQ 682 Drosophila willistoni
XP_002005830        638 HK-FCRRNIPF-----KHLPIVQEEFPhSVEDFIETTDPSVEDEIAYNEWLL 683 Drosophila mojavensis
EDW01951            638 HK-FSKRNIPF-----NHLPPVQSEYPhTIEDFIESTDPSVEDELAYKEWLL 683 Drosophila grimshawi
4_pfamImport        473 TK-FSQYGYTP-----PFLPIPAREYE-INPEIIEVLDPTPEEEEAWR---- 513
EFC43249            491 IK-NTGIPYTP-----ILPSKVVEDVKePVDQV----DPKPNDAKRMlqgle 532 Naegleria gruberi
Q4DE57              534 LN-KTDFSFTP-----TLAPPVLPECG----DITEVDDPTPATEKLVRRGED 575 Trypanosoma cruzi
EAX89949            437 MKaQKPLEWPPlpvkkPPPPPPKEEEEkNENE-----EEEKGEEGAEKTNTE 483 Trichomonas vaginalis G3
CAM69627            642 LKdMQGAYYAP-----PLPPPCFREYVeAPGEFDGQRDCTIDEELRYAPPpp 688 Leishmania infantum JPCM5
Q4DHQ3              531 LKsLQGMNYAP-----KLPPRCLVEYPeTE--LVLQRDATADDELEYAPPpp 575 Trypanosoma cruzi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap