Conserved Protein Domain Family
ApoA-II

?
pfam04711: ApoA-II 
Apolipoprotein A-II (ApoA-II)
Apolipoprotein A-II (ApoA-II) is the second major apolipoprotein of high density lipoprotein in human plasma. Mature ApoA-II is present as a dimer of two 77-amino acid chains joined by a disulphide bridge. ApoA-II regulates many steps in HDL metabolism, and its role in coronary heart disease is unclear. In bovine serum, the ApoA-II homolog is present in almost free form. Bovine ApoA-II shows antimicrobial activity against Escherichia coli and yeasts in phosphate buffered saline (PBS).
Statistics
?
PSSM-Id: 398403
Aligned: 11 rows
Threshold Bit Score: 108.301
Threshold Setting Gi: 611999539
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EHB13639      25 AEEPDLQGLFSQYFQTVTSYGKDLLQKTKPQDLQAQVQSYFEKTQEQLVPLVKKAGTELFNMLSNMIELkKTQPA 99  naked mole-rat
XP_007485040  25 AQDQGVQSIFSQYFQKLTDIGKDLAEKVKAPEVQTQVQQYFKKSQDQVIPLAQKALTDTMSFFSSLVEA-GKKDA 98  gray short-tailed op...
XP_003769682  25 ATEPEVTDFFTQYIRKLADIGKDVAEKVQVPEVQSQVQAYLEKSHEQVIPLAKKALTDTITFFSSLVES-GKKav 98  Tasmanian devil
P09813        25 ADGPDMQSLFTQYFQSMTDYGKDLMEKAKTSEIQSQAKAYFEKTHEQLTPLVRSAGTSLVNFFSSLMNL-EEKPA 98  house mouse
P04638        25 AAETDVQTLFSQYLQSLTDYGKDLMEKAQPSEIQNQAKAYFQNAQERLTPFVQRTGTNLMDFLSRLMSP-EEKPA 98  Norway rat
ELV13288      25 AEEPNLEGLVSQYVQTLTDYGKELVNKAKGQELLVQAKAYFEKIQERLTPLVNEVRADLPKFFNYFVDL-QAQPA 98  Chinese tree shrew
XP_003785901  25 AEESSLQSLFSQYFQTMADYGKDLVEKVKTPELQAQAEAYFAKSKEQLTPLVKKAGTDLVNFFNYFVDF-GTQss 98  small-eared galago
XP_006907920  25 AEESNVQGLLSQYFQTVADYGKDLVDKAKGSELQAQA--YLEKTQEQLTPLVKKAGNDLIHFFSYFTDL-KT-PA 95  black flying fox
XP_003466639  25 TEESNLQRLFSQYFQTMTSYGKDLLEKVKAQELQTQAQAYFTKTQEELVPLVKKAGNDLFNILSNFVDF-KKTQP 98  domestic guinea pig
E2RAK7        25 AEEPNLQSLVSQYFQTVTDYGKDLMEKAKGPELQAQAKAYFEKTQEQLTPLVKKAGTDLLNFLSNFMDL-KTQPA 98  dog
XP_004775983  25 AEEPDLQSLISQYSEMVATYGKNLVEKVKDPELQAQAKAYFENTQEQLMPLVQKVGVDLINFLSNFMDF-KKQPA 98  domestic ferret
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap