Conserved Protein Domain Family
Pellino

?
pfam04710: Pellino 
Pellino
Pellino is involved in Toll-like signalling pathways, and associates with the kinase domain of the Pelle Ser/Thr kinase.
Statistics
?
PSSM-Id: 398402
Aligned: 17 rows
Threshold Bit Score: 679.445
Threshold Setting Gi: 74966461
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_015784371       26 DSNYPIFYGELVILGYNGNLPHGEKGRRRSKFILTQRNVPNGVKKSKHYVVKQ-PQQTKAIQDKGKHSISYTLSRTQAVI 104 two-spotte...
EKC24574          363 QNRSAIKYGELIILGYNGHLPSGDKGRKKSKFILGKKPSGNGVKPFRKHVVKN-AQAAKALQDPQSHSVTYTLSRHQAVV 441 Pacific oy...
XP_009008738       17 QTSNSVKYGELVILGYNGCLFNGDKGRRRSKFQLFKRQVPNGVKAAKHHIVNN-PQQSELIQNCHQHSVSYTLSRSQAVI 95  Helobdella...
FlyBase:CG5212-PB  21 HDKPRLRYGELVILGYNGYLPQGDRGRRRSKFVLHKRTEASGVKRSKHYIVQS-PQTSKAILDANQHSISYTLSRNQAVI 99  fruit fly
KYB26669           61 KPKQLVKYGELVILGYNGFLPQGDRGRRRSKFVLYKRPTANGVKRSKHYVVKT-PHSSQAILDANQHSISYTLSRNHAVI 139 red flour ...
XP_011146164       59 KPKQLVKYGELVILGYNGYLPPGDRGRRRSKFVLYKRPVPNGVKRSKHYIVKT-PHSSQAILNTKQHSISYTLSRTQAVI 137 Jerdon's j...
EEB13345            6 EEKKSIKYGELVILGYNGFLPPGDRGRRRSKFVLYKRLQPNGVKKSKHYVVKT-PHSSQAILDSKQHSISFTLSRNQAII 84  human body...
XP_001625826        2 sSTEPLTYGMLVVLGYNGAPPQGNQERRKSSYLLQKKSLASGVKPFKQHLASS-QTGMQVVHSNQAHSVSYTLARGPSVV 80  starlet se...
NP_001027714       43 EDEGDIIYGQLIVLGTNGQLPTGDKGRRRSCFTLRRKRKATGVKPSDQHQVYQkASHSETFLSKDHHSVSYTLPRS-VVV 121 vase tunicate
XP_002589172       13 PEKAQLKYGELVVLGYNGSLPYGEKGRRKTRFTLFKRAAANGVKPSTHHIAKT-PQASKIVADKSHHSVSYTLSRNQTVV 91  Florida la...
XP_015784371      105 VEYTPDNETDMFQIGRSSESPIDFVVIDTVSPDKPVG----DTLAQQSTISRFACRILVERNPPYTARIYAAGFDSSRNI 180 two-spotte...
EKC24574          442 VEYKQDEDTDMFQIGRSSEPPIDFVVMDTIPGNLRSM----NEGITQSTISRFACRILVDRNPPYTARIYAAGFDSGKNI 517 Pacific oy...
XP_009008738       96 VEYDHDCNTDMFQIGRSSEEQIDFVVMDTIPGTQRGD----QSVIMQSTISRYACRILVDRTHPYAARIYAAGFDNGKNI 171 Helobdella...
FlyBase:CG5212-PB 100 VEYKEDTETDMFQVGRSSESPIDFVVMDTLPGDKK------DAKVMQSTISRFACRILVNRCEPAKARIFAAGFDSSRNI 173 fruit fly
KYB26669          140 VEYTPDDDTDMFQIGRSSEAPIDFVVMDTVPGDKTG-----ETKVMQSTISRFACRILCDRKNPKIARIYAAGFDTSKNI 214 red flour ...
XP_011146164      138 VEYTEDEETDMFQIGRSSESPIDFVVMDTCAGGGDGGpa-nEGRVAQSTISRFACRILADRSDPRIARIYAAGFDSSRNI 216 Jerdon's j...
EEB13345           85 VEYMPDEETDMFQIGRSSDPPIDFVIMDTIPGEKQG-----EERVNQSTISRFACRILADRSNPKICKIFAAGFDSSRNI 159 human body...
XP_001625826       81 VEYCRDNKTDMFQIGRSSDSKIDFVVMDTVPGVKDGAv---QPNPQKSTISRYACRITVDRHPPYTARVFAAGFDKSNNI 157 starlet se...
NP_001027714      122 VPYVHDDNSDMFQIGRSTEEPIDFVLMDIEAGSSIPTnhkpQTQPKQSTISRFACRIVCDREHPYTSRIYAAGFDTSMNI 201 vase tunicate
XP_002589172       92 VEYVRDEDTDMFQIGRSTEPPIDFVVIDTVPGNKTAE----DCKVQQSTISRFACRIVVERNPTHTARIYAAGFDSSNNI 167 Florida la...
XP_015784371      181 FLGEKATKWQHD-GE---MDGLTTNGILIMHPKTTFCSngnviddipnsGQKYCLWREVSVCGGIYAIRETRSASEKGDK 256 two-spotte...
EKC24574          518 FLGEKAVKWYVG-EE---IDGLTTNGVFIMKPQEGFYP-----------PGKPGVWREVSVGGAIYPLRESRSAPLKTNQ 582 Pacific oy...
XP_009008738      172 FLGEKATKWYTD-GE---IDGLTTNGILIMHPINGFTE-----------NSKTGLWRELSVEGGLYALRESRSAPNKGNL 236 Helobdella...
FlyBase:CG5212-PB 174 FLGEKATKWQDN-VE---IDGLTTNGVLIMHPKGSFCGg----------NAKCGLWRECSVGGDVFSLRESRSAQQKGQP 239 fruit fly
KYB26669          215 FLGEKATKWQENgRE---IDGLTTNGVLIMHPRGTFCGg----------DAKCSYWLETSVGGGVFSLRESRSAQQKGQV 281 red flour ...
XP_011146164      217 FLGEKATKWQEN-RE---IDGLTTNGVLIMHPRGQFCGg----------EAQCGFWREVSVGGGVFSLRESRSAQQKGNV 282 Jerdon's j...
EEB13345          160 FLGEKATKWQEG-RE---IDGLTTNGVLIMHPIGNFVDg----------DSKPGVWREVSVGGGVFSTRESRSAQQKGSV 225 human body...
XP_001625826      158 FLGEKAPKWKNEdDM---MDGLTTNGVLLMNPRGGP-------------NCPPGIWREISVCGHVYGLRDTRSAPEKGKT 221 starlet se...
NP_001027714      202 ILGEKAPKWTTEqNGkkiIDGLTTNGVLIMQPKNGFSE-----------SSTPTQWKETSVCGNIYQLRESRSAQLPGIR 270 vase tunicate
XP_002589172      168 FLGERATKWKRPdSS---MDGLTTNGVLIMHPTGGFGQ-----------ECKAGVWREVSVCGGIYSLRETRPNPQRGKL 233 Florida la...
XP_015784371      257 IDLETNILKDGTLIDLCGATLIWRSAEGLLRSPTKKSLEDMIDDLNAARPQCPVGLNTLVISRKSSTL--CEk-EKQPYV 333 two-spotte...
EKC24574          583 IKDEDNVLQDGTLIDLCGATLLWRSALGLISSPSEHEFENLVETINAGRPQCPVGLNTLVLPKKGTLG--LS--DRQPYV 658 Pacific oy...
XP_009008738      237 VSTENNVLKDGTLIDLCGATLVWRSNEGLVQGPTLVELEKQIEQINASRPQCPVGLNTLVLPCKNSMT--DN--EKAPYV 312 Helobdella...
FlyBase:CG5212-PB 240 IYDECNILQDGTLIDLCGATLLWRSAEGLQHSPTKHDLEKLIDAINAGRPQCPVGLNTLVIPRKVNIG--DQ--VNQPYV 315 fruit fly
KYB26669          282 VENETNILEDGTLIDLCGATLLWRSAEGLTKSPSKRDLEREIDEINAGRPQCPVGLNTLVIPRKVTPN--EN--LQQPYV 357 red flour ...
XP_011146164      283 VEDENNILQDGTLIDLCGATLLWRSAEGLAKSPTKQDLEELVDAINAGRPQCPVGLNTLVIPRKAATD--ST--QQQPYV 358 Jerdon's j...
EEB13345          226 IANETNILQDGTLIDLCGATLLWRSAEGLAKSPNRDYIEALVDKLNAGKPLCPVGLNTLVIPRKGTAD--SSneMEQPYV 303 human body...
XP_001625826      222 VQNESNVLFDGSLIDLCGAVLMWRSADAIPTMPTEGMIDAMRRRLNMMRLQCPVGLNTLVFSGASQVI--SLraSRQPHV 299 starlet se...
NP_001027714      271 MPEDNNVLVNGTLIDLCGATLLWRSSSHERCMPTPLHIDELIHKLNLGRPQCPVGLTTLAFPRRSKAT---KetEKQPWV 347 vase tunicate
XP_002589172      234 IDDESNVLHDGTLIDLCGATLLWRSSAGLQKTPTHKHIEELRKEINAARPQCPVGLNTLAFPTRSRTTkvTEekERQPYV 313 Florida la...
XP_015784371      334 YLNCGHVQGLHDWGQSKNSNA----RTCPMCLSVGPVVRLTMGIESSFYVDCSSPT-FAFNPCGHMASERTVRFWSSIAI 408 two-spotte...
EKC24574          659 YLQCGHVHGQHQWGQKDDKTA----RTCPLCLKDGTFIKLKMGCELSFYADSDPPT-HCFNPCGHMASEKTVRYWSELPV 733 Pacific oy...
XP_009008738      313 YLKCGHVHGQHSWGKGDDLNN----CTCPMCREVGPFVKLQLGEETSFYNDNGIIT-HCFSPCGHMASEKTVRYWSTVQI 387 Helobdella...
FlyBase:CG5212-PB 316 YLNCGHVQGHHDWGQDENTGA----RRCPMCLELGPVVTLCMGLEPAFYVDVGAPT-YAFNPCGHMATEKTVKYWANVEI 390 fruit fly
KYB26669          358 YLNCGHVQGLHDWGQDKDSGA----RKCPICLELGPVVKVFMGLEPAFYVDSGPPT-FAFNPCGHMATEKTVKYWANVAI 432 red flour ...
XP_011146164      359 YLKCGHVQGHHDWGQEKDKVT----RRCPMCLVAGAVVKLSMGIEPAFYVDCGPPT-YAFSPCGHMATEKTVKYWEKVAI 433 Jerdon's j...
EEB13345          304 YLNCGHVQGQHSWGQDKDSDA----RRCSLCFKVGPVVKVTMGIEPAFYVGIKSGNfYAFSPCGHMTTEKTAKFWSQTAI 379 human body...
XP_001625826      300 YIKCGHVHGLHGWHGPDSSTDvtesRTCPICLQVYNYVPLQIGKERAFFVGEIVSS-HAFVPCGHVCSEETVRFWSKIPI 378 starlet se...
NP_001027714      348 YLQCGHVHGRIEWGYQGEEE-----RICPLCRSVGKYVPLWVGGEPAFYVDIGPPS-YCFVPCGHVCSQKTAIYWSQTAL 421 vase tunicate
XP_002589172      314 YLNCGHVHGHHLWGQKENENGd---RECPMCRTVGPYVPLYMGNEPAFYVDCGPPT-HAFCPCGHVCSEQTARYWAQVPL 389 Florida la...
XP_015784371      409 PHGTNGFHAMCPFCGTPVSGKLGFVRLIFQDHVD 442 two-spotted spider mite
EKC24574          734 PHGCQGFQAICPFCATPLCAETGFIKLIFQDNTD 767 Pacific oyster
XP_009008738      388 PHGCLGFQPACPFCATVLNELNPWVRLIFQDNMD 421 Helobdella robusta
FlyBase:CG5212-PB 391 PHGTNGFQAVCPFCATPLDGATGYIKLIFQDNLD 424 fruit fly
KYB26669          433 PHGTNGFHAVCPFCASPLAGSPGYVRLIFQDNVD 466 red flour beetle
XP_011146164      434 PHGTNGYIAICPFCAVPLEGTPGYVKLIFQDNVD 467 Jerdon's jumping ant
EEB13345          380 PHGTNGFDAVCPFCATPLTGYPGYIRLIFQDNVD 413 human body louse
XP_001625826      379 PHGCDAFQAICPFCSLPLEGEDGFVKLIFSteq- 411 starlet sea anemone
NP_001027714      422 PHGTQAYSAACPFCATPLEGDLGYKKLIFQQPLD 455 vase tunicate
XP_002589172      390 PHGVHAFHAACPFCATQLTGEQGFIKLIFQN--D 421 Florida lancelet
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap