3DWL


Conserved Protein Domain Family
P16-Arc

?
pfam04699: P16-Arc 
Click on image for an interactive view with Cn3D
ARP2/3 complex 16 kDa subunit (p16-Arc)
The Arp2/3 protein complex has been implicated in the control of actin polymerization. The human complex consists of seven subunits which include the actin related proteins Arp2 and Arp3, and five others referred to as p41-Arc, p34-Arc, p21-Arc, p20-Arc, and p16-Arc. The precise function of p16-Arc is currently unknown. Its structure consists of a single domain containing a bundle of seven alpha helices.
Statistics
?
PSSM-Id: 398396
Aligned: 122 rows
Threshold Bit Score: 151.903
Threshold Setting Gi: 308267540
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3DWL_G         2 TFRTLDVDSITEPVLTEQDIFPirneTAE-QVQAAVSQLIPQARSAIQT---GNALQGLKTLLSYVPYGNDvQEVRTQYL 77  fission yeast
XP_002131724   9 AFRRIDVDQYDEEKFMDDQ-----------TDQGDTGPDANNVNNLLMG---GKAVDALKACLQNPPVRTKdASVKEKAT 74  vase tunicate
XP_001892979   9 SYRKLDVDAFDPEKFVDCEd----------AETPGIGPDERLVNQLLQS---AKLQEALKASLSNPPLKCKnQAIKDRST 75  Brugia malayi
XP_002639570   9 SYRKLDVDAFDPEQYDEND---------EtVDTPGLGPDERAVQGFLSS---NRLEDALHAALLSPPLKTKdQNVKDRAT 76  Caenorhabditis ...
P91167         5 DYKKYNVDIFHPAHFEDIQ-----------EESADCGPNVQEVRQFLES---NRLEYALQSVLLNPPFGHSeQELKNRAV 70  Caenorhabditis ...
XP_001950711   9 AFRKIDVDQFNEN-FKEDE--------QPeNQSTTAIPDESEITTMINQ---GRFADALKSALKNAPLGSKnQQLRDNAL 76  pea aphid
XP_015789278   8 gFRKIDIDSFNDDVFKEDDQVV--------SQSSGTSLDDKEILQLCSA---GKHYEAIKSIFDLQPQSSGdSAIKELAF 76  two-spotted spi...
XP_002410106   9 AFRKIDIDQYNEDNYKEDE-------APDaQSNAQAGPDEQEVLDALTCvckGKNVDALKIILKAAPIGSKcQSVKDATS 81  black-legged tick
EFX87860       9 AFRKIDVDQYNEDNYKEDE--------CGeSQSPPVGPDEKEITNFLNQ---GKSVEALKTVLRNAPISSRnQMVKDAAL 77  common water flea
KAE9429882     9 AFRKIDVDLYNEDSYREDE--------QGeLQSPPAGPDPTEVSQLLDQ---GSNIEALKVVLRNAPLASRnQQVKDSAL 77  Apolygus lucorum
3DWL_G        78 NAFVDVLSNIRAADIPAFVKECSTEEIDNIVNFIYRGLANPQAYNSSV-LLNWHEKVVEISGIGCIVRVLNSRP 150 fission yeast
XP_002131724  75 LLFVRVISTIKASEISGALQSLSVEEVDTIMKYIYKGFSLGLDGQQCGyLLSWHEKVAAKGGMGCIIRVLSDRK 148 vase tunicate
XP_001892979  76 ALVTKVLMNIKTADIESVVKSLTDDEVNLLMKFIYKAMDTQADNATCQyLLLWHAQVLARGGYGAIIRVFCDRQ 149 Brugia malayi
XP_002639570  77 QLVAKVLQSFKNAEIEQAVQKLSIDEGDILMKYVYKAMELGSDAAACQsLLGWHAQLVSKFGHGAIMRVFSGRQ 150 Caenorhabditis briggsae
P91167        71 LLVAEVIHAFRQTDIEESVHKLSNENGDILMKYIYKAMQLCSDSATCLsLLLWHSQLVSKFGQGSIVRVLSNRQ 144 Caenorhabditis elegans
XP_001950711  77 NVVMKVLLATKLSQIDEVVAQLDVDMVDILMKYIYKGFEKSTEKKSSH-LLMWHEKAYAIGGAGSIIRVLTDRK 149 pea aphid
XP_015789278  77 NLIMQVFLAVKTGDIDRIVDKLDTDQIDLLMKYVYKGFESPQEGSSSN-LLVWHDKIFRKSGHGAIVRVLTDKK 149 two-spotted spider mite
XP_002410106  82 ALVMRVLLAVKASEIEKAVGSLDRDSVDVLMKYIYRGFESPSEGSSGH-LLAWHEKAYAAGGVGSIVRVMTDRK 154 black-legged tick
EFX87860      78 NIVMQVLLSVKSTQIEEAVNALDRDQLDILMKYIYRGFETPSEGSSGQ-LLAWHEKVHAVAGVGCIVRVLTDKK 150 common water flea
KAE9429882    78 NLTMKVLMSFKSSQIDDAVAQLDTESIDILMKYIYRGFEFPSEKRSGQ-LLLWHEKVYAVGGVGSIVRVLTDTK 150 Apolygus lucorum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap