Conserved Protein Domain Family
Rab_eff_C

?
pfam04698: Rab_eff_C 
Rab effector MyRIP/melanophilin C-terminus
This domain is found at the C-terminus of the Rab effector proteins MyRIP and melanophilin.
Statistics
?
PSSM-Id: 398395
Aligned: 8 rows
Threshold Bit Score: 1099.53
Threshold Setting Gi: 0
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002759799 153 FDILG-GSLFESNLENEGSISGSDSTFYRQSE-GHSVMDTLAVALRVAEEAIEEAISKAEA-YGDSLDKQNEASYLRDHK 229 white-tufted-ea...
XP_008113754 153 SDLLEvGSICEGTIENDGSICGSDSTFYRQSE-GHSMMDTLAVALRVAEEAIEEAISKAEMfSNNSLDKQNEARYLRDHK 231 green anole
XP_007505104 153 FDIIE-ASFLEPSLENEGSISGSDSTFYRQTE-GHSMMDTLAVALRVAEEAVEEAISKAEA-SGDSLDKQNEACYLREHK 229 gray short-tail...
3_pfamImport   2 FDLIE-GSFLEPSLENEGSISGSDSTFYRQSEaGHSMMDILAVALRVAEEAVEEAISKAEA-SGDSLDKQNEASYLREHK 79 
Q7TNY7       153 FDILG-GGLYEPNLENEGSISGSDSTFYRQSE-GHSMMDTLAVALQVAEEAIEEAISKAES-QRDSLDKQNEASYLRDHR 229 Norway rat
XP_003477045 154 DVLA--GGFLESHLENEGSASGSDSTFYRQSE-GHSMIDTLAVALRVAEEAIEEAISKAEA-HADSLDKQNEATYLRDHR 229 domestic guinea...
XP_002938352 153 ADIVE-GNFIDESIENEGSLCGSDSTFYRQTE-GHSMMDTLSVALRVAEEAVEEAIAKADS-YRDSLDKQNEACYLREHK 229 tropical clawed...
XP_031446239 153 PDVIE-GGCFEGSFENDGSICGSDSTFYRQTE-GHSMMDTLAVALRVAEEAVEEAISKAET-YSDSLDKQNEACYLQEHK 229 Ring-necked phe...
XP_002759799 230 EELTEELATTILQKIIRKQKSKSEQQv-EEEPGWPHP--QSCSTKVA--DEGTSAPPGGHRAPTALW-RSQSAFSVTGED 303 white-tufted-ea...
XP_008113754 232 EELIEELATTIVQKIIRKQKNKTEQV--EAGTDWPQSrsSSGPTSVTlsDQSMLTFPGSRRGSYTLW-RSQSAFSLTTEE 308 green anole
XP_007505104 230 EELIEELATTIVQKIIRKQKSK-EQT--EKESDWTQP--SSNARKVT--GQRMPAFPGEQQASCSLLqRSQSAFSLTGQE 302 gray short-tail...
3_pfamImport  80 EELIEELATTIVQKIIRKQKDKGEQT--EKDCDWPQP--SSSTRKVS--SQQIPAFPGGEQASCTLL-RSQSAFSLTGEE 152
Q7TNY7       230 QELAEELAGTILQRIIRKQKDKADLHaeEEEPECTRP--QSSGVKAR--GEGTAAPPGRHKARAALW-RSQSAFSFTTED 304 Norway rat
XP_003477045 230 EELTEELAATILQKIIRKQKSRSEQHr-EEEPEWPLL--RDCSAKEE--DEGHKAALGDPRVPTALW-RSQSAFVFPGGD 303 domestic guinea...
XP_002938352 230 EELIEELATTIVQKIIKRKKSKSEQA--EAIYEWQQSr-GSAITSPAtsDRSMLNLQDSNRGSDALW-RSHSAFSLMSED 305 tropical clawed...
XP_031446239 230 EDLIEELATTIVQKIIKKQKGKTEQA--EADFEWPPSr-SSGLASVAvsDQSMLTFPGSRRGSYTLW-RSQSAFSLASED 305 Ring-necked phe...
XP_002759799 304 A------LKTPPVEAASRQPGDQGQHPRAE--SALPSWKSVDRLDETNLA-PVLQSSDGNWVALKDGA-PPPTRLLAKPK 373 white-tufted-ea...
XP_008113754 309 AssrdvdLASSVSESLWKQPKAPVRSQKDHrlSALPSWKSVDRLNEPTFP-PVLESTDGNWVALQNVT-LPHPRMLAKPK 386 green anole
XP_007505104 303 ApskeskVSAPL-ETLWAEQRVQEQKPKEQehAALPSWKSMDRLDETNLEdPVLQSADGNWVALKNKL-FPHHRLLAKSK 380 gray short-tail...
3_pfamImport 153 ApskdsqVSAPP-ETPWAEQRVQAQKPREQeyAALPSWKSMDRLNETTLW-PHLAAPANNYITSKKNSlLPPVYRKKKKK 230
Q7TNY7       305 T------LKTSSAEAAPRQPKDRAQRLLEE--SALPSWRSMDGLDGKNLV-PLLQSPDGNWMTLKDSSrQPPTRLLAKPK 375 Norway rat
XP_003477045 304 P------GKTPSLEAVVR------QRPGQP--CALPGWRSVDGLDGTGAA-PVLQSPDGNWVALKDGA-APPAHLLATRK 367 domestic guinea...
XP_002938352 306 TpstnvdMKSARPEVLCQHPRNCSKRAKERrpSTLPSWKSVDSLYDSSPS-PVLHSSDGNWVALQSIT-LPPPRMLAQPK 383 tropical clawed...
XP_031446239 306 TpskgldPASSVTEALWRQQKGQFKKQKERklSALPSWKSVDRLNETNPP-PVLQSTDGNWVALQNIS-LPRPRMLAKPK 383 Ring-necked phe...
XP_002759799 374 SG-----------------TFQALEVASSVASAYDEMGSDSEEDFDWSEALSKLCPRPRGLPR-----NPQPQPTQAQSS 431 white-tufted-ea...
XP_008113754 387 SQ-----------------VFRVLENESNVVSAYDEMGSESEDDYDWNVALNKLRRRPKHLSNs---aDSPCNTEWAYGN 446 green anole
XP_007505104 381 SQ-----------------AFQALEKESSVVSAYDEMGSDSEDDFDWNMTLNKLHQRPQSLSEnsystDSPHHTEWAYGH 443 gray short-tail...
3_pfamImport 231 KKkkkisgaeiaefaniqcSLCAMHHVESVL-----IGN----------VLNSL--------------APPSLPILLDAS 281
Q7TNY7       376 SR-----------------TFQALEVASSVASAYDELGSDSEEDFDYSEALSKLRPPSQGRLK-----QPQPQPAQAQSS 433 Norway rat
XP_003477045 368 SA-----------------TLQALEVTSRASSAYEGLGSDSEEDFDWSMALGELCLQPQ-------------------SS 411 domestic guinea...
XP_002938352 384 SQ-----------------VFKALEDESRVVSAYDEMGSESDEEVDWSLALNAYRRRARDLSDdscyaDSQYNPEWACSN 446 tropical clawed...
XP_031446239 384 SQ-----------------VFEALENESSVVSAYDEMGSDSEDDYDWNVALNKLRRRPRQLPDdfyctNSQYDSEWVYGN 446 Ring-necked phe...
XP_002759799 432 DQGPMAASPISAISPNpEAMCSDSETS---------SAGSSREVGHQAR-----LSWLQRKAPRNPA-AEKMRLQGEL-- 494 white-tufted-ea...
XP_008113754 447 ELHQPMTSPSSGLFAN-ETMCSDSETS---------SINSSREARGTSL-----PPWIQRRTCNNKSrEDKAQLHGEL-- 509 green anole
XP_007505104 444 DQCPRGTSPSSGLYTNtEAMCSDSETS---------SVSSSREVQGPAK-----RPWLQRKPPSNHS-LEKAHLQGGL-- 506 gray short-tail...
3_pfamImport 282 ETPPPPGSP------------PDSSSTqaipfyrghSENCFFENQTPGRnikglLLWINKQAGENLN-SENLVIQGYLys 348
Q7TNY7       434 GQGPLATSPS-----NpEAMCSDSETS---------STSSSREAGCRAK-----LLWLQRKAPKNPS-AEKTHLQGEL-- 491 Norway rat
XP_003477045 412 NHGPLAASPSPAASPNpEAMGSDSES----------SAGCSQDSRHGAR-----PSWPPRKAPWNPA-AERVHLQGEL-- 473 domestic guinea...
XP_002938352 447 DYYQPVTSPSSGLYTNtETVYSDSETS---------SLNSLKETRQSSK-----SLWPNRKVPFNQ--IQKDHGYGKM-- 508 tropical clawed...
XP_031446239 447 DQYQAVTSPSSGLYTNtETLFSDSETS---------SVNSSQEAKGPSK-----LLWLQSRTQSDVPrMEKKHFHGEL-- 510 Ring-necked phe...
XP_002759799 495 DVNFNPQAASGETSDSSEPEEAPHTTDRRARRWRRARLGSEEPSKEPSSPSAQHRDLDTRQ-MLGDLSETDISNEAQDPR 573 white-tufted-ea...
XP_008113754 510 DVNFNPQTTSLDYSDSSESEEAYHDLEKRSKRWKKSKAISEDLCRGKNRTKTHKKTLSTSQ-ASEDLSETDISSEDQQHQ 588 green anole
XP_007505104 507 DVNFNPQATDTQDSDSSEAEATHHTADKRSRRWRRNKLASEELGEEQPPTQSHEKDSDSNQ-VFDDLSETDISSEDHHHK 585 gray short-tail...
3_pfamImport 349 GWTLKDKICGGEASEKAEPNQSIYMSKSR-----RNHVKPAGNQPGIRGGKYLPKIVETDTvVFDDLSETDISSEDHHHK 423
Q7TNY7       492 DVNFNPQAAGGETSDSSDPEETLHTADRRARRWRRARVGPEESNRGLPSPSAYPPALHTAQ-VSDNVSETDISNEAQNSR 570 Norway rat
XP_003477045 474 DVNFNLQAAGGNTSDSSEPEEAPHEMDQQARRWHRACLDPKEQC----TPDSHAVHPHVHQ-VPSNLSETDLSNEAADSR 548 domestic guinea...
XP_002938352 509 DINFNPQSNSMEYSDSSEAEKTHFDVEKKSRRWKRNKTEIEEQGD---FMKGQKRSLSTNT-AFSDVSETDTGNRGPHHR 584 tropical clawed...
XP_031446239 511 DVNFNPQATSLEYSDSSETEEVQYDLEKRSRRWKKNKTISEELCEGKNHTKANVKNLS--Q-DLDDLSETDRSSEDQHHN 587 Ring-necked phe...
XP_002759799 574 TPTDTTEEKRRNRLYELAMKMSEKETSSGEDQESEPKTESENQKESLSSEDNSQSVQEELKKKFSAVSLCNISTEVLKVI 653 white-tufted-ea...
XP_008113754 589 TMADPLEEKLKSRLYELAAKMSDSRETSSEEQVSEPRTESENQKSCISSEDSGKRVQDELKKKYSAVSLCNISTEVLKVI 668 green anole
XP_007505104 586 SRTNDTEDKLKSRLFELAAKMSEKETSSGEEQESEPRTESDHQKGSLSSEDNGQCIQEELKKKYSAVSLCNISTEVLKVI 665 gray short-tail...
3_pfamImport 424 SRTNTTEEKLKSRLFELAAKMSEKETSSGEEQESEARTESDPQKESLSSEDNGQCIQEELKKKYSAVSLCNISTEVLKVI 503
Q7TNY7       571 SSTDSAEEKLRNRLYELAMKMSEKETSSGEDQESESKTEPKNQKGSLSSEENNQGVQEELKKKCSAVSLCNISTEVLKVI 650 Norway rat
XP_003477045 549 TSIDTAEEKQRSRLYELAMKLSEKGTSSGEDPESEPRTEPEDPKEGLSSEESTRSVQHELRKKYSAVSLCNISTEVLKVI 628 domestic guinea...
XP_002938352 585 TMTDNLEQKLKTKLCELTAKISDKETSSGEEQDPEFRVENRNPE--MLSEESGMCVQEELKKKYSAVSLCNISTEVLKVI 662 tropical clawed...
XP_031446239 588 IKPELMEEELKSRLFQLAAKMSDKETSSGEEQESEPRTDPENQKESLSSEENGKSIQEELKKKYSAVSLCNISTEVLKVI 667 Ring-necked phe...
XP_002759799 654 NATEELIAESTGPWESPQVPPDREKGTFPRGTDQVRLDEQLTSLEENVYLAAGTVYGLESQLTELEDAARSIHSGTEETH 733 white-tufted-ea...
XP_008113754 669 NATEELIAESTGPCDFPADTHDKGKGEFPLGTDPIRLDEQLTTLEENVYLTAGSVYGLEGQLNELEEAAREINSITAESE 748 green anole
XP_007505104 666 NATEELIAESTGPWDFPADPPEKEKGPFPLGTDHVRLDEQLTSLEENVYLTAGTVYGLEGQLNELEDAARRISSTTGELE 745 gray short-tail...
3_pfamImport 504 NATEELIAESSGPWDFPADPPKREKGTFPRGTDHVRLDEQLTSLEENVYLTAGTVYGLEGQLNDLEDAARRISSTTGESE 583
Q7TNY7       651 NATEELIAESAGPWEIPPVSTDRDNGMFPLGTDQRSLDKQLTSLEENVYLAAGTVYGLEGQLSELEDAARCIHSSTGETE 730 Norway rat
XP_003477045 629 TATEELIAESTGPWELPPVAAGTEERTFPLGTNQARLEEQLTSLEENVYLAAGTVYGLEGQLTELEDAARCIHSGTQDTE 708 domestic guinea...
XP_002938352 663 NATEEMIAGSSGPWESPANTHDR--GSFPIGADPVRLDEQLTKLEENVYLTAGTVYGLEGQLSEIEDSARKISSVTTELE 740 tropical clawed...
XP_031446239 668 NATEELIAESTNPCDFPDDVQDKGRETFPLGTDPIRLDEQLTTLEENVYLTAGTVYGLEGQLTSLEDAARQISSVTAESE 747 Ring-necked phe...
XP_002759799 734 LADLEDQVATAAAQVHHAELQ------------------ISDIESRISALTIAGLNIAPCVSLTRRRNQKQRTQVQTIDT 795 white-tufted-ea...
XP_008113754 749 LADLEDQVATAAAQVHHAERQ------------------ISDIESRISALTVAGLNVAPCIHLRRKREQQQTNQMHTIDT 810 green anole
XP_007505104 746 LAELEDQVATAAAQVHHAEQQmrnsgpergtdlpkatgvISDIESRIAALTLAGLNVAPCDRLTRKRNQKQMNQVQTIDT 825 gray short-tail...
3_pfamImport 584 LAELEDQVATAAAQVHHAELQ------------------ISDIESRIAALTLAGLNVAPCVRLTRKRDQKQMNQVQTIDT 645
Q7TNY7       731 LADLEDQVAAAAAQVHHAELQ------------------ISDIESRISALTIAGLNIAPCVRLTRRRDQKQRSQVQTIDT 792 Norway rat
XP_003477045 709 LAELEDQVASAAAQVHHAELQ------------------ISDIESRISALTIAGLNIAPCVRFTRKQEQKRRSQVQTIDS 770 domestic guinea...
XP_002938352 741 LADLEDQVATAAAQVHHAERQ------------------ISDIESRISALTIAGLNVAPCVRLTRRRELISSSQVQTIDT 802 tropical clawed...
XP_031446239 748 LAELEDQVATAAAQVHHAELQ------------------ISDIESRISALTVAGLNVAPCVHLTRKRDQKQTNQMHTIDT 809 Ring-necked phe...
XP_002759799 796 SRQQRRKLPAPPVAAEKNETSSVTTIKTFNRNYILQGSSKNRTK-ERKITTKDLMEPALESAVMY 859 white-tufted-ear marmoset
XP_008113754 811 SRQQRRKLPAPPVKGENVNVSPVTPVKTFNRNFILQGSLTQRTKmERKSTAKDLKEPTIGSAVMY 875 green anole
XP_007505104 826 SRQQRRKLPAPPVKNEKMEAASLTSVKTFNRNFILQGSMTQRTK-ERKSTAKDLMEPTPGSAIMF 889 gray short-tailed opossum
3_pfamImport 646 SRQQRRKLPAPPVKNEKIEAASLTSVKTFNRNFIIQGSMTQRIK-ERKSTAKDLMEPTLGSAIMF 709
Q7TNY7       793 SRQQRRKLPAPPVKAEKIEASSVTPIKTFNRNFLLQGSSTNRPT-ASTSNTKDLMEPVLESAVMY 856 Norway rat
XP_003477045 771 SRQQRRKLPAPPVRAENTEACSVTTVKTFNRNFILQGPASR----PAESSPQDLTEPVLESAGMY 831 domestic guinea pig
XP_002938352 803 SRQQRRKLPATPLqDEESEGSVVTAMRTFNHNFVLQGSLTQRTK-ERKNAAMDVMEPTKGSTIMY 866 tropical clawed frog
XP_031446239 810 SRQQRRKLPAPPIKGEKIDGSPITTVRTFNRNFMLQGSLTQRTK-ERKSTAKDLMEPAIGSAVMY 873 Ring-necked pheasant
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap