5L87


Conserved Protein Domain Family
Pex14_N

?
pfam04695: Pex14_N 
Peroxisomal membrane anchor protein (Pex14p) conserved region
Family of peroxisomal membrane anchor proteins which bind the PTS1 (peroxisomal targeting signal) receptor and are required for the import of PTS1-containing proteins into peroxisomes. Loss of functional Pex14p results in defects in both the PTS1 and PTS2-dependent import pathways. Deletion analysis of this conserved region implicates it in selective peroxisome degradation. In the majority of members this region is situated at the N-terminus of the protein.
Statistics
?
PSSM-Id: 398392
Aligned: 34 rows
Threshold Bit Score: 59.8489
Threshold Setting Gi: 549047908
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5L87_A         9 EREKRVSNAVEFLLDSRVRRTPTSSKVHFLKSKGLSAEEICEAFTK 54 
EDK45065       1 MNDELINSAVAFLQDPNVATSPLAKKIEFLESKGLDQVEIEEAMKR 46  Lodderomyces elongisporus NRRL YB-4239
CBX91132       2 VREDIVTSAVSFLQDPSVASAPLEKRIAFLQSKNLTQEEIDVSLAR 47  Leptosphaeria maculans JN3
EPE05119       3 IREDLVASAAKFLQDPSVAASSSDSRVAFLKAKNLTPEEVSAALAR 48  Ophiostoma piceae UAMH 11346
EGC32847     136 IREDMVKKAYSFLSNPSVKNTPLARKVAYLEKKGLTSDEIKEALKR 181 Dictyostelium purpureum
XP_011667045  48 PREKMIETAVKFLLNPQVRSSPMAQKKAFLRKKGVKDAEIELAIDR 93  purple sea urchin
XP_009395025  43 VRDEQVLNAVKFLSHPKVRGSPVIYRRSFLEKKGLTKEEIDEAFRR 88  wild Malaysian banana
KJE89490      53 LREDLLDTATKFLRNPKVQQAPKAKRVAFLEQKGLTAAEIDEAFRR 98  Capsaspora owczarzaki ATCC 30864
EPB87385      64 IREDMIKPAVSFLSSPNVRSADREKKIAFLQKKGLTQAEITEAFKR 109 Mucor circinelloides f. circinelloides 1006PhL
CCX32043      49 EREKLLENAITFLERS--RDAPLDQKQEFLRAKGLSPEEVEDLILK 92  Pyronema omphalodes CBS 100304
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap