Conserved Protein Domain Family
DDE_Tnp_2

?
pfam04693: DDE_Tnp_2 
Archaeal putative transposase ISC1217
Statistics
?
PSSM-Id: 147046
Aligned: 3 rows
Threshold Bit Score: 469.403
Threshold Setting Gi: 74506525
Created: 20-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010923767   1 MTKEL--TREEYYKALEKAVNEVilSMTGTRKDVAKRLLLGAVVGRNAT--EIAQEAEMDYETVLNNLDKAAQA--KLIE 74  Saccharolobus s...
Q5MPE9         3 SEKELdiARTEFIKSFNYLIGTL--RMNGLRRKVAVGLALMTLIGGRASirNASITFKLNYANLLKTLENLENTwrDYLE 80  Sulfolobus sp. ...
Q96YJ0         1 MNTNS--LLQEYYKALREALQQIftALTSVRKDTLTRLVLGGVMGGTAT--EIAQAVDMDYETVLKNLDKLANI--NLIK 74  Sulfurisphaera ...
Q5MPE9         3 SEKELdiARTEFIKSFNYLIGTL--RMNGLRRKVAVGLALMTLIGGRASirNASITFKLNYANLLKTLENLENTwrDYLE 80  Sulfolobus sp. ...
Q96YJ0         1 MNTNS--LLQEYYKALREALQQIftALTSVRKDTLTRLVLGGVMGGTAT--EIAQAVDMDYETVLKNLDKLANI--NLIK 74  Sulfurisphaera ...
WP_010923767  75 VVKKLVGDhPVLLIVDDTHDHKLYARAMPV-SRNGAQIFYCRAHKRFEPAIQLLVIGVKDLVNNQIYVIHIIAYIPRKVE 153 Saccharolobus s...
Q5MPE9        81 ALSKVIIG-PVVVIIDDTFDHKLYSRVEGIaSKYGNYFAWCSTHKRFEPGIQVLTIALYDLAMGKSYLIGAFPYATRKMW 159 Sulfolobus sp. ...
Q96YJ0        75 IVKEIVKDhPVQLIIDDTHNHK--ARALPV-SRNGTQAFYCREHKRYEPAIQLLIIAIKDLYTNETYIITIIPYIPQKVA 151 Sulfurisphaera ...
Q5MPE9        81 ALSKVIIG-PVVVIIDDTFDHKLYSRVEGIaSKYGNYFAWCSTHKRFEPGIQVLTIALYDLAMGKSYLIGAFPYATRKMW 159 Sulfolobus sp. ...
Q96YJ0        75 IVKEIVKDhPVQLIIDDTHNHK--ARALPV-SRNGTQAFYCREHKRYEPAIQLLIIAIKDLYTNETYIITIIPYIPQKVA 151 Sulfurisphaera ...
WP_010923767 154 EelkrRGEEVKFKTKIDALLEFLSSL-SGLNVKARVFDSWYVNSRTLQGNTVGELKSSARVVE-----------GGRSVP 221 Saccharolobus s...
Q5MPE9       160 E----SGMVSEFKTKIEMAAEIIEILkERFHVARVVFDSWYWSEKLVKGSVVSELKSNRRLIRvrpleggktlgVEGHPH 235 Sulfolobus sp. ...
Q96YJ0       152 EilkeRGEKAEYKTKIQLYLETLPTIlNEYNVTTISFDSWYVNSKTLLPNTIGELKANSRVVE-----------GDRHVP 220 Sulfurisphaera ...
Q5MPE9       160 E----SGMVSEFKTKIEMAAEIIEILkERFHVARVVFDSWYWSEKLVKGSVVSELKSNRRLIRvrpleggktlgVEGHPH 235 Sulfolobus sp. ...
Q96YJ0       152 EilkeRGEKAEYKTKIQLYLETLPTIlNEYNVTTISFDSWYVNSKTLLPNTIGELKANSRVVE-----------GDRHVP 220 Sulfurisphaera ...
WP_010923767 222 VSEFPQGEYLVEYL--GTPIKLLVIDDYKGYGRRYFFSTDLNDTAEDIITTWENRWDIEVLIRELKALGLEGGSFLTWVR 299 Saccharolobus s...
Q5MPE9       236 VGDLPPGSYLAELTlgDQVITIKLLILVYKDNRLNLYTTDLNLSDEEIEATWKIRWEIEKLHKDIKALGMQDSSFLKRKR 315 Sulfolobus sp. ...
Q96YJ0       221 VAEFPEGEYLVEYL--GTPIKLLVIDNYKDMGKRYFFSTNTKDTPEDIITTWENRWDIEVVIRELKALGLEKSSFLTWIR 298 Sulfurisphaera ...
Q5MPE9       236 VGDLPPGSYLAELTlgDQVITIKLLILVYKDNRLNLYTTDLNLSDEEIEATWKIRWEIEKLHKDIKALGMQDSSFLKRKR 315 Sulfolobus sp. ...
Q96YJ0       221 VAEFPEGEYLVEYL--GTPIKLLVIDNYKDMGKRYFFSTNTKDTPEDIITTWENRWDIEVVIRELKALGLEKSSFLTWIR 298 Sulfurisphaera ...
WP_010923767 300 NSGFVALKALSLLVVQYFKYSTGLMLG 326 Saccharolobus solfataricus
Q5MPE9       316 LQGYLLLFVMVVNAARDLVTSLNLKSV 342 Sulfolobus sp. L00 24
Q96YJ0       299 NKGFITLKALSLLLVLSFKYSLGLRLG 325 Sulfurisphaera tokodaii
Q5MPE9       316 LQGYLLLFVMVVNAARDLVTSLNLKSV 342 Sulfolobus sp. L00 24
Q96YJ0       299 NKGFITLKALSLLLVLSFKYSLGLRLG 325 Sulfurisphaera tokodaii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap