Conserved Protein Domain Family
YABBY

?
pfam04690: YABBY 
YABBY protein
YABBY proteins are a group of plant-specific transcription involved in the specification of abaxial polarity in lateral organs.
Statistics
?
PSSM-Id: 398389
Aligned: 57 rows
Threshold Bit Score: 214.853
Threshold Setting Gi: 224112084
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_004976365  26 EQ-EQLCYVHCKCCDTILAVGVPCSSLFKTVTVRCGHCANLLSVNLRGLLL--PtAAAn----nQLPFggqqqallspts 98  foxtail millet
XP_002316077  13 LSsDHLSYVRCNFCNTVLAVRIPFKRMLDTVTVKCGHCNNLSFLSTRS-----PnLGNfld------------------- 68  black cottonwood
ERN02354      10 FP-EQLCYVQCTFCDTILLVSVPCSSMLKMVTVRCGHCNNLLSVNMKLRASflPl-HLissltnQvpt------------ 75  Amborella trich...
CBI28560      10 LQ-EQICYVQCGFCTTILLVSVPYSSLSMVVTVRCGHCASLLSVNMMKASFv-Pl-HLlas-lsqDEP------------ 73  wine grape
Q9LDT3        17 LP-GQICHVQCGFCTTILLVSVPFTSLSMVVTVRCGHCTSLLSVNLMKASFi-Pl-HLlaslshLDETgkee-------- 85  thale cress
KRH45646      10 LP-EQICYVQCGFCTTILMVSVPCSILSTVVTVRCGHCTSLLSVNMKKASFv-Pf-HLlas-lthLEP------------ 73  soybean
KRH74572      58 LP-EQICYVECGFCATILMVSVPSSSLSMVVTVKCGHCTSVLSVNMMKASFv-Pf-HLlas-lshLEP------------ 121 soybean
KRH52947      10 LP-EQICYIQCGFCNTILMVSVPCSSLSMVVTVRCGHCTNLLSVNMLKASFi-Pf-HLlas-lshLEP------------ 73  soybean
EEF37031      10 LP-EQICYVQCGFCDTILLVSVPGSSLSMVVTVRCGHCTSLLSVNMMKVSFv-PfQQLlaslthDQQ------------- 74  castor bean
XP_018685796   6 LP-EQVCYVNCSFCNTVLVVNIPGNNSFSIVTVRCGLCANILYVNLEGLHGvlPl-QNfqn------------------- 64  wild Malaysian ...
XP_004976365  99 phglldemmpfqqAPSLTsaepasacvst----itsinnscggrNNASAmsmapp--plkpaPQEPQlPks--aASGNRT 170 foxtail millet
XP_002316077  69 ------------idhHHLslqgvssnekllfketqgfctdfrkgEYSSS-------------STSSEpLvp-kvPFVVKP 122 black cottonwood
ERN02354      76 -----------------------------------------lslSLSQAsqelridtpintsSPKKDeItp--pKHVNKP 112 Amborella trich...
CBI28560      74 --------------KEGCpneegaqka--------sdkrspsmvASSDN---------------EEDdIvp-vhHVVNKP 115 wine grape
Q9LDT3        86 -----------vaaTDGVeeeawkvnqe-------kenspttlvSSSDN---------------EDEdVsr-vyQVVNKP 131 thale cress
KRH45646      74 --------------KEGAsddganksln-------synnasiitTNSDC---------------EEEnVtq-isNVVHKP 116 soybean
KRH74572     122 --------------KESSseqdanktl---------krhnasmmTYSDC---------------EEEdAip-msNVVNKP 162 soybean
KRH52947      74 --------------KESSpeedanktl---------nshsasmmTYSDC---------------EEEdIipmshHVVNKP 115 soybean
EEF37031      75 --------------KEEInlegpdarkt------ldierslsmaACSDD-------------NKLEEdKnp-vnRVINKP 120 castor bean
XP_018685796  65 ----------hnlGSQHLhmdfgsssnct----------------------rlsvmnpvdyvQQQMQlIh------PT-- 104 wild Malaysian ...
XP_004976365 171 AEKRQRVPSAYNRFIKDEIQRIKASNPDITHREAFSAAAKNWAHFPHIHFGL 222 foxtail millet
XP_002316077 123 PEKKHRLPSTYNRFMKEEIQRIKAANPEIPHREAFSTAAKNWARYlpnsgag 174 black cottonwood
ERN02354     113 PEKRHRAPSAYNRFIKEEIQRLKAREPTITHKEAFSAAAKNWAHFPRIPFNv 164 Amborella trichopoda
CBI28560     116 PEKRQRAPSAYNRFIKEEIRRLKAENPKMTHKEAFSTAAKNWAHFPAIQlkg 167 wine grape
Q9LDT3       132 PEKRQRAPSAYNCFIKEEIRRLKAQNPSMAHKEAFSLAAKNWAHFPPAHNKr 183 thale cress
KRH45646     117 PEKRQRTPSAYNRFIKEEIKRLKSENPNMAHKEAFSTAAKNWANFPPsqcdg 168 soybean
KRH74572     163 PEKRQRTPSAYNCFIKEEIKRLKAENPDMAHREAFSTAAKNWANFPPTqcke 214 soybean
KRH52947     116 PEKRQRTPSAYNCFIKEEIKRLKAENPEMTHKEAFSTAAKNWANFPQTqwck 167 soybean
EEF37031     121 PEKRQRAPSAYNRFIKEEIRRLKAENPDMAHKEAFSTAAKNWANNPPIHYKe 172 castor bean
XP_018685796 105 -EKR-RAPSAYNRFIKEEIRRLKTKNPNISHKEAFSRAAKNWAHFPEIHMGL 154 wild Malaysian banana
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap