Conserved Protein Domain Family
Glyco_transf_54

?
pfam04666: Glyco_transf_54 
N-Acetylglucosaminyltransferase-IV (GnT-IV) conserved region
The complex-type of oligosaccharides are synthesized through elongation by glycosyltransferases after trimming of the precursor oligosaccharides transferred to proteins in the endoplasmic reticulum. N-Acetylglucosaminyltransferases (GnTs) take part in the formation of branches in the biosynthesis of complex-type sugar chains. In vertebrates, six GnTs, designated as GnT-I to -VI, which catalyze the transfer of GlcNAc to the core mannose residues of Asn-linked sugar chains, have been identified. GnT-IV (EC:2.4.1.145) catalyzes the transfer of GlcNAc from UDP-GlcNAc to the GlcNAc1-2Man1-3 arm of core oligosaccharide [Gn2(22)core oligosaccharide] and forms GlcNAc1-4(GlcNAc1-2)Man1-3 structure on the core oligosaccharide (Gn3(2,4,2)core oligosaccharide). In some members the conserved region occupies all but the very for N-terminal, where there is a signal sequence on all members. For other members the conserved region does not occupy the entire protein but is still to the N-terminus of the protein.
Statistics
?
PSSM-Id: 398374
Aligned: 18 rows
Threshold Bit Score: 323.1
Threshold Setting Gi: 237757320
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9VUH5        30 MDITKIEP----VEPRVVKNKTKvprmyaktinhdgnwetivtnpeLKPRYRVGGGRTGVQ-FVIGVPTVLRPKKNYVLQ 104 fruit fly
Q9VUH4       129 IRLPNAYH----FLPHLLDDAGS-----------------------LRPAYLQSKGRSDVS-IVLGVPTVRREKQSYLLG 180 fruit fly
Q16HU9       118 LKLPTAFH----FLPHLLDDPAS-----------------------LRPGYLQTKNRQGVS-MVLGIPTVKRDKQSYLLE 169 yellow fever mo...
Q9D4R2        96 ETLPNQFEvlkyFLPHLRTAGK------------------------LYPAIATSKGRAGVS-FALGISTINRGNHTYLKQ 150 house mouse
XP_025318086  96 ETVSDTFEilkfFFPHLRKVGR------------------------IYPDVIFGKKRTGVS-FALGISTVNRGNQSYLSQ 150 dingo
NP_776132     64 SKIKNHLK----YFTEMQESSHVlq--------------------hVTYTVLAGASYQPKRmLTVGIFSVPHSHRTHLLD 119 house mouse
XP_012041315  53 PSRTNYVE----TFKDMQKNSEPlk--------------------nVDSCILIGAPPVKKRlLTIGISSMKRPQRSYLLD 108 sheep
XP_005622219  52 PGRTNPLE----TFKNMQKNSELlk--------------------nINSHILIGAPPMKKKlLTIGISSVQHPHGSSLLD 107 dog
XP_004756382  53 PGRTNHLE----TFKNMQKKLELfk--------------------nINAQILIGAPPLKKKlLTIGIASVQHSSGSYLLD 108 domestic ferret
XP_019832567  96 ETVSDAFEvlkfFFPHLRKVDR------------------------IYPDVIMGREKTgVT-FALGISTVNRGNYSYLKQ 150 zebu cattle
Q9VUH5       105 TVDCLIRRMTPEQRDNCLIVIFVGETKLQFAKFIVRELRVNHSTHMQAGLIDVIAPPLNYYPNFSRLHITLNDDPQRVQW 184 fruit fly
Q9VUH4       181 TLHNLIENMNDEEQNETLIIVYIGETDMESVQLIARQIESSFDQHVESGLIDIIAPAPSYYPNFERLRITLNDPLERVKW 260 fruit fly
Q16HU9       170 TVDNLIANMDEDEQNDTMIVIFIGESDFDYVSQVANSINARFPTFVESGFIEVISPAASYYPDMAKLRLTLNDSAERVKW 249 yellow fever mo...
Q9D4R2       151 TLTSVLSRMTPEEEEDSVVIVSVADTDESYLKSVVRMVKTKFRKQVQSGVLEVISIPTLFYPQTLLDKKTKTDS---ESW 227 house mouse
XP_025318086 151 TLNSVVSRMSPSEEKDSVVIVSVADRNEDYLKYVVDMITKRFKRQLKSGSLEVISIPAFFYPNILPLTQSTEDSGKLESW 230 dingo
NP_776132    120 TMTSLFQASSEQDLEYMLVLVLLSDTDPTWLNQTVANISGLFMPHIDSGRLLVVHGRLG-----GSRAKSRNDTSPCGKL 194 house mouse
XP_012041315 109 TLESLFYSSSLSEQKHFIVLVHLADPDPMWHSQMISNISTIFKPYIQASQLVVINTPLKSYLPLKSLKRNFNDTPTYVAF 188 sheep
XP_005622219 108 TLQSLFFASSSSERKHFIVVVHLADPDPKWLGQMISNISTLFKLYIQAGQLVVINTPLTSYLLLNNLKKNFNDIPAHVAF 187 dog
XP_004756382 109 TLQSLFIASSSSEQKHFTVLVHLADPDPKWLDHMISNISTLFKPYIQARQLVVINTPRKNYLLLKDLEKNFHDTPAYVAF 188 domestic ferret
XP_019832567 151 TLTSILSRMTLPEEKDSVVIVSIADSNENYVKSVVDMITKKFKRQVTSGSLEVISIPAYFYPNISHAARSTDDSEKLEsw 230 zebu cattle
Q9VUH5       185 RTKQNLDYIYLMSYAKSRGLYYLQLEDDVMANVGFMDYIQKFAVLHGSfriaqqIDWIVMSFSELGFIGKLFRTSVLSSF 264 fruit fly
Q9VUH4       261 RSKQNLDFAYLMAYAHSKGTFYVQLEDDILTKRQFITTMKKFALIKSAltkpdqPEWFVLDFCQLGFIGKMFKSAELPYL 340 fruit fly
Q16HU9       250 RSKQNLDFAYLMAYAQPKGAFYVQLEDDILTKKGFITIMKNFALEKTAkk--eqSQWFVLDFCQLGFIGKMFKSADLPWL 327 yellow fever mo...
Q9D4R2       228 QIKQVLDFCILMLYAQPKATYYLQLEDDIVAKKMYFTKMKDFVNSLTS------KNWFFIEFSVLGFIGKLFRSKDLTDF 301 house mouse
XP_025318086 231 RIKQVLDFCFLMLYAQPKAMYYLQLEDDIIAKKMYFTKITDFVHNGTS------NNWFYIEFSILGFIGKLFKSEDLTDF 304 dingo
NP_776132    195 YSRQKTSLALLMNFALNLSEYFLLLGDNVKTAPKFLANVFWALPAWKQ------LPWVSLDFSSMPLSGKVFHTEDLSRF 268 house mouse
XP_012041315 189 RSKRNMDYAFLMNFATNHSDYFLMIEDDVKCVPGFVTQIATTVSAWEN------KPWVTLEFSPLGFTGKLFRTKDLPCF 262 sheep
XP_005622219 188 YSKQKMDYAFLMNFATNHSDYFLMIADDVKCAPGFVTQIATIVSAWEN------RLWMTLNFSQLGFIGKLFHTRDLPRL 261 dog
XP_004756382 189 HFKQNMDYAFLINFATNLSDYFLMIEDDVTCAPGFVTQIATAVSAWRN------KPWLTLNFSQLDFTGKLFRTRDLPCL 262 domestic ferret
XP_019832567 231 RIKQVLDFCFLMLYAQPKAMYYLQLEDDILANKMYLTKITDFVHNITS------NNWLYIEFSVLGFIGKLFKSEDLTDF 304 zebu cattle
Q9VUH5       265 VAYLKLFYNDQPIDWLLQSFVTLQSCRWDSvSDPECQRDFESRLLRSSQSQFQHMGAQSSLADKQQYQKDAFF 337 fruit fly
Q9VUH4       341 ITYFQMFYNDKPVDWLLTYFIESKVCRTDK-DQKHCNAEKAKYWQHFRKSLFQHIGTSSSLKGKVQKLKDKQF 412 fruit fly
Q16HU9       328 ITFFQMFFNDKPVDWLLSNLIYTKVCSIEK-DGKICKQEMTKLWIHYKPSLFQHIGTTSSLRGKVQKLKDKQF 399 yellow fever mosquito
Q9D4R2       302 VHFFLMFYETKPIDILLDDIFLIRVCISGE-PVRSCLQRKKGFRIQYRPSLFQHVGTQSSFPGREQHLKDNYY 373 house mouse
XP_025318086 305 VRFFLMFYKDKPIDLLLGDIFQVKMCDPGE-TPEKCAERNKHIRIRYKPSLFQHVGIQSSFPGREQYSKD-IY 375 dingo
NP_776132    269 VSFLLLFPKDIPTHLLLSEFRLLLS---------------QNVPIRLSPSVFYRMDRDSEFEDTCFPAKRDKD 326 house mouse
XP_012041315 263 VNFLLLFYQEMPCDSLLSHFHDLLM---------------QQTPVQFLPSLFQHMGNYSSSEGKFNSLKDIEF 320 sheep
XP_005622219 262 VQFLLLFCQEMPCDYLLSNFYDLLI---------------QQTPIQFFPSLFQPMGNYS-FEGKFKSLKDKEF 318 dog
XP_004756382 263 VHFLFLFYQKMHCDYLLTHFHDLLM---------------EPAPIQFFPSLFQRMGNYSFFDSKFNSLKDKEi 320 domestic ferret
XP_019832567 305 VRFFLMFYKDKPIDLLLGDIFLVKMCTPGE-ALEKCIERNKHIRIRYKPSLFQHVGIQSSYPGREQYFKiavf 376 zebu cattle
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap