Conserved Protein Domain Family
OGFr_N

?
pfam04664: OGFr_N 
Opioid growth factor receptor (OGFr) conserved region
Opioid peptides act as growth factors in neural and non-neural cells and tissues, in addition to serving in neurotransmission/neuromodulation in the nervous system. The Opioid growth factor receptor is an integral membrane protein associated with the nucleus. The conserved region is situated at the N-terminus of the member proteins with a series of imperfect repeats lying immediately to its C-terminus.
Statistics
?
PSSM-Id: 398373
Aligned: 16 rows
Threshold Bit Score: 306.159
Threshold Setting Gi: 74682635
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_016080819  14 EGESDMVNLRFYKNEIPFQPNGLHINEILKNWKNDYDILEDNHSYIQWLFPLREQGVNWYAKPLTAREIQEFKSSDEVMK 93  platypus
XP_008108379 124 vEEAEMWNLSFYKNEIRFMPNGLHIDDLLEKWQNDYGILEENHSYIQWLFPLREQGMNWRAKLLTCQEIEAFKKSKEVME 203 green anole
NP_001314975 100 RQPNEYRNLRFYLNKIPLVPDGIYIEEILTKWRGDYDKLEHNHTYIQWLFPLREQGLNFYAQELTQDEIKEFQSTREAKR 179 zebrafish
XP_017949213  64 RSPNDLCNLRFYMNKIPFKPDGVNIEEILNKWKGDYEKLEHNHTYIQWLFPLREQGLNFYAKELTSYEIEEFKKTKEAVK 143 tropical clawed...
XP_014723955  49 RYQNDLSNLRFYKNKIPFKPDGVYIEEVLNKWKGDFEKLEHSHTYIQWLFPLREQGLNFYAKELTTYEIEEFKKTKEAIR 128 ass
NP_001298278  65 cPEERMTNLKFYLNEIKSSPDDVSIETFHTEWRTDYKRLERVHSYIQWLFPLREPGVNYMAAELTKKEIQAFRESEEAKS 144 zebrafish
XP_015220427  74 YSRGKMFNLKFYLNEIGTEPDGIMIKEFLQNWKQDYKKLERNHSYIQWLFPLREPGMNYMAYELTREEIEEFHKNEVAKQ 153 spotted gar
NP_001068572  68 FQINPLYHLKFYRGEIKAAPVAIHIDGFHKEWWGQYDLLEKAHYYIQWLFPIQRKVNNWRIHCLRKKEIMLFRRDEDVKH 147 zebrafish
3_pfamImport   1 STRRDKLNLQFYLGMTRSVPDGVSIDGFHQDWYKDYDRLESVHSYIQWLFPLQEPGMNRDASILTTEEIEEFLQSNIAKE 80 
CAF96845       1 --------------------SGIYIHTFHSDWFERYHKLESVHTYIQWLFPLQEPGMNYRAPPLTRQEIRAFLGSDLAKR 60  spotted green p...
XP_016080819  94 RFVQAYELMLGFYGIELVDPELGVVKRANNYPKRFQNLNWHSHNNLRITRILKCLGEMGYEHYQAPLVKFFLEETLVKHR 173 platypus
XP_008108379 204 RFVRAYKLMLGFYGIEMINEETGELRRAENWCERFENLNRYSHNNLRITRILKCLGEMGYEHYQVRLVQFFLTETLVHQK 283 green anole
NP_001314975 180 RFLLAYTIMLDFFGIKLLD-KNGNVSRASNWQDRFQHLNESQHNYLRITRILKSLGELGFESFKLPLVRLLLEEALVEGT 258 zebrafish
XP_017949213 144 RFIVAYKMMLDFFGIELSD-KNGNVSRAPNCQERFQHLNESQHNYLRITRILKSLGELGYENFKPPLVKLFLQESIVANT 222 tropical clawed...
XP_014723955 129 RFLLAYKMMLEFFGIKLTD-KTGNVARAANWQERFQHLNESQHNYLRITRILKSLGELGYESFKSPLVKFILHEALVENT 207 ass
NP_001298278 145 RLLDSYELMLGFYGLQLLNRETGEVKRADNWRERFANLERNMHNNLRITRILKSLGELGFEHFQAPLVRFFLEETLVRKT 224 zebrafish
XP_015220427 154 TLIQSYELMLGFYGIELVNKETGEVKRAWNFEDRFDNLDRNMHNNLRITRILKCLGELGFEHYKAPLVKFFLEETLVNKE 233 spotted gar
NP_001068572 148 KLIKSYKVMLDFYGIRLADEKTGKVERAENWKQRFNNLNRNTHNNLRITRILKCLGTLGLEHYQAPLVKFFLHETLFQGQ 227 zebrafish
3_pfamImport  81 NLLKSYKLMLDFYGIELSDEKTGEVRRACNWRDRFNNLNRRTHNNLRITRILKCLGTLGYRHYQAPLVHFFLKETLVHRE 160
CAF96845      61 NLLKSYKLMLDFYGIRLENERTGAVKRAPNWAERFQNLNMNTHNNLRITRILKSLGTLGYPHYQAPLVRFFLEETLVHQT 140 spotted green p...
XP_016080819 174 LQNVKQSALDYFVFTVKNKHLRRELVYYAWKNFKPPNKFVWGPLQKLQ 221 platypus
XP_008108379 284 LPNVLMSALDYFMFTVRSKQKRRDLVHFAWQHYKPRREFGWGPHKKLR 331 green anole
NP_001314975 259 LPNMRHSALEYFVFTLRQHAQRRALLRFARRHYQPPENFIWGPPKKKR 306 zebrafish
XP_017949213 223 IPNMKQSALEYFVYTIKDRRQRRKLLRFACYHYEPPEHFIWGPPDKQK 270 tropical clawed frog
XP_014723955 208 IPNIKQSALEYFVYTIRDRRERRKLLRFAQKHYTPSENFIWGPPRKEp 255 ass
NP_001298278 225 LSSVKRSVLDYFLFAVRDKRERRKLVRFAFQHFEPKDKFVWCP-RKIQ 271 zebrafish
XP_015220427 234 LSSVKRSVLDYFLFSIRDKRKRRELIEYAYQHFEPKDKFVWCP-RRVQ 280 spotted gar
NP_001068572 228 LKNVKQSVLDYFMFAVLDKSKRRELIRYAYLYFKPRKDFVWGSKKILE 275 zebrafish
3_pfamImport 161 LPQVRDSVLHYFVFAVLDKRERRRLLKFAYLSYDRREEFVWCP-KKIQ 207
CAF96845     141 LPGVKDSALNYFLFAVLDKRQRRKLVRFAYSSYDQDQPFVWCP-RNlq 187 spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap