Conserved Protein Domain Family
DUF599

?
pfam04654: DUF599 
Protein of unknown function, DUF599
This family includes several uncharacterized proteins.
Statistics
?
PSSM-Id: 398367
Aligned: 127 rows
Threshold Bit Score: 74.8891
Threshold Setting Gi: 552834776
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003566999        10 VLVPLGLAVLAAYHLWLLYAILRHPTRTVVGLNALARKRWVAAIManPEKNGVLAVQTLRNNIMASTVLATTAITLVSVI 89  stiff brome
WP_013682865         8 TALAIYLLCFAGYHGTYFILLKKCPHRAVKAYINKLREDGIEYMI--KRGDQIVVVQALRDAIMVCNLFASSTLIFIGAI 85  Archaeogl...
WP_015590276         8 FALIVFLICFAGYHGSYLILSKKYPKKVVKTYTNIFREKGIENVI--KKREPLVLVQQLRDAIYVSNLFASASLIFIGML 85  Archaeogl...
WP_011797715        16 agalATLGIPLAYEAWSCAAARHRPLSRARGAHAHLRADWLDAVSa-QPGSEILAVQTLRNALMSATMAASTAMLGLMGT 94  Acidovora...
Q121R8               8 lASLITVAILLVYEAALLLVQRRNPARLARSAHANLREEWLAALSr-QRGSEILAVQTLRNSLMSATMTASTAALGLMGA 86  Polaromon...
XP_005848819        20 LGYNIFYFSVASFTFFKRRYI------ILYAVNRQSRASWVQHLSk-DSKEGINAVQTIRNQVLAVSILAATTAPLAAQL 92  Chlorella...
CAL62653             9 ALLASGLLLL-AYYLFLMMRVKRDPNFTVHSVNQKARALWVMDVMrsQGKKDVMAVQTLRNFGMTATFKASSSILLILGT 87  Herminiim...
WP_014322032        15 LAVSAGLFT--FYHLYVRHKLKANPTYSLYGATTIARTAWVVNVM--EEKNDILAVQTLRNSTMAATFLASTSILLAVGL 90  Desulfovi...
gigasnome:DGI_1228  15 lLASAGLYG--CYHLFLQCRLRRDPFYTMQAYTELARKAWVASVM--TGQKDLLAIQTLRNATMAATFLASTAIILAVGV 90  Desulfovi...
WP_009207659        14 FLISVSLVI--AYQLYLKYKEAKNPAYTVAAVNVMARSAWVETIM--REGKDILAVQTLRNSTMAATFLASTAILLIIGV 89  Sulfurice...
XP_003566999        90 SVFIGATAgggrssaplQL-----GVYGS-KSGQAFA--AKYMAISLCFMLAFVCNVQAIRLYAHAS------------- 148 stiff brome
WP_013682865        86 LNLLINMD----------KlarnmGV----WNLHHFQ--FKILFMVGVLSVSFIFLVSALRYYRLVA------------- 136 Archaeogl...
WP_015590276        86 LNLLINLN----------TlaeslKI----TDVGLFE--FKILFIAALQAISFIFFVSSLRYYRMVS------------- 136 Archaeogl...
WP_011797715        95 VGIAAPSLr-------aLLqgaatPA----PDSAVLAaaVLELALLVLLCASLTAMVAAVRHYHHAG------------- 150 Acidovora...
Q121R8              87 ATLAAPSLn--------ASladgeALFGQfTARLALE-----LVLMTVLFASLVCSAMAVRYYNHAG------------- 140 Polaromon...
XP_005848819        93 INVITDTAklq----qvADfsksdPI----SSVALFSpqIKLGIALGILLLAVMAYAQSVRLSVHIGervcrlrrlplgy 164 Chlorella...
CAL62653            88 LTLSGQAEn-------mAKawhvlDIAGS-RAADLWV--IKIMCLLSVLLVAFFAFSMTLRLLNHVV------------- 144 Herminiim...
WP_014322032        91 LTLSGQADk-------lGEtwhamNLFGS-RAESTIT--LKLLIILGNLFIAFFNFSFAIRLFSHVG------------- 147 Desulfovi...
gigasnome:DGI_1228  91 LSMASQTGr-------lIQtwhvlTSIDT-TAQSLFG--FKLLLLVVNLFGAFFSFSMSVRLYNHLG------------- 147 Desulfovi...
WP_009207659        90 LTLSGQEAr-------lGStwhslNAIGA-KHSGLWL--AKLLLLLLDLFIAFFSFSMSVRVFNHVG------------- 146 Sulfurice...
XP_003566999       149 --FLL-GLPSWAgpedeeaegpaaAAAAREEWVAYVARTVNRGSHAWSLGLRAFYVSLALFLWTFGPIPMLACSVLMCAL 225 stiff brome
WP_013682865       137 --VLVmAPPESI------------QKYTGEPAHRYLGKALNSGCTYYTLGSRGLIYSLLILLWLVNTEAFVAVVVGITIL 202 Archaeogl...
WP_015590276       137 --LLAtTPPETI------------REHLGIEAYKYLAHLLNRGCSFYTLGSRGILYSILLLAWFVNEWLFMAIVVLTTVL 202 Archaeogl...
WP_011797715       151 --FVAgM-PV--------------GSPARQRWTPTGRDHLHKAGLFYSRGLRWLILGVPVTAGLLHPLAGVLVAVLWVAG 213 Acidovora...
Q121R8             141 --FISsM-PV--------------DSDERHRWTPTGVVYLRRAGLLYSWGLRHLLMVAPLLASIVYPLAGPVAAVIVVVA 203 Polaromon...
XP_005848819       165 tiRVVaS-----------------DPTGYTGLSHLSVTLMRRSSLYFAIGLRLFFVFGPLVLWIIGPTTLLVATLLDVAA 227 Chlorella...
CAL62653           145 --FMV-NLPE--------------ADAQGSLSPQRIAQRLNSAGVFYTLGMRAFFVAVPLTFWLFGPLFLFLSTAGLIVA 207 Herminiim...
WP_014322032       148 --FLI-NTPP--------------EEGSYGASITFVAMELNKAGGYFHMGMRAYYFLVPLIFWLFSPLFMLAATVTLVLI 210 Desulfovi...
gigasnome:DGI_1228 148 --FLI-NTPS--------------DEAGRCQSMEFVALELNRAARHFHKGLRAYYFMMPLLFWLYGSAMLLLATAGMIAV 210 Desulfovi...
WP_009207659       147 --YMI-NVPV--------------ALNHKAISPAHVATHLNRAGMFYHFGMRAYYYIVPIVFWLFGPHFMLIATLGLLIV 209 Sulfurice...
XP_003566999       226 LYF-LDTTSTS 235 stiff brome
WP_013682865       203 LAKyRDFRHKA 213 Archaeoglobus veneficus
WP_015590276       203 FAKyRDFVRDR 213 Archaeoglobus sulfaticallidus
WP_011797715       214 LMR-WDAPhav 223 Acidovorax citrulli
Q121R8             204 LLG-FDRFTpa 213 Polaromonas sp. JS666
XP_005848819       228 QFL-FDVvpaa 237 Chlorella variabilis
CAL62653           208 LYH-LDRspla 217 Herminiimonas arsenicoxydans
WP_014322032       211 MSR-IERtpdl 220 Desulfovibrio desulfuricans
gigasnome:DGI_1228 211 MFW-LDRTPRV 220 Desulfovibrio gigas DSM 1382 = ATCC 19364
WP_009207659       210 LYR-IDRApki 219 Sulfuricella denitrificans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap