Conserved Protein Domain Family
DUF604

?
pfam04646: DUF604 
Protein of unknown function, DUF604
This family includes a conserved region found in several uncharacterized plant proteins.
Statistics
?
PSSM-Id: 398362
Aligned: 67 rows
Threshold Bit Score: 368.774
Threshold Setting Gi: 514774122
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_004967904 216 QDLTHSYGMAFGGGGFAVSYPAAAELAGAIDGCLDRYRELFGSDERVHACLSELGIPLTREPGFHQLDLRGDAYGLLSAH 295 foxtail millet
KRH22518     212 Q--VFGFGMAFGGGGFAISSSLAQVLAKVFDSCIQRYSHLYGSDARVYSCITELGVGLTHEPGFHQVDLRGDIFGLLAAH 289 soybean
KRH56089     202 QNRVFGFGMAFGGAGFAISSSLAKVLAKVFDSCIERYPHLYGSDGRVYSCLAELGVGLTHEPGFHQVDLKGNTFGILAAH 281 soybean
XP_002515719 196 QNRYFSFEMAFGGAGFAISYPLAKVLAKVFDSCTERYPHLYGSDSRISSCLAELGVGLTREPGFHQVDLRGNMFGLLTSH 275 castor bean
XP_006846343 223 QNMAHSYDMAFGGGGYAVSYPLAKALSRIFDDCIRRYQTLYGSDHIIQSCVAEVGVRLTKEPGFHQIDLLGDIYGLLSAH 302 Amborella trich...
XP_002280577 227 sNIDHSFEMAFGGAGYALSYPLAEALARNLDVCIKRYPTLYGSDHILQSCVADLGVSLTHEKGFHQIDLHGDLSGLLSAH 306 wine grape
XP_010317971 217 sNFGMSFQMAFGGAGYALSYPLAQALAKNMDTCIKRYPYLYGSDHILQACIADLGVTITLEKGFHQIDLRRDISGFLSAH 296 tomato
XP_015161354  57 sNYWYSFNQAFGGAGIIMSYPLAKEFAKNVMSCLKRYAHLTSADRTTMNCIADIGVNLSPLQGIHQIDLRGDISGFLSYH 136 potato
XP_013665496  37 sNFRLAFEMAYGGGGYALSYPLVEALVAKLDECIEKYHFIWAGDKLQSYCLADLGADLIPEKGFHQMDLRGDLSGLLSSH 116 rape
CBI28968     158 QNRLFSFDMAFGGAGFAISYPLAKVLAKVFDSCLERYPHLYGSDSRVYTCLAELGVGLTREPGFHQVDVRGETFGLLAAH 237 wine grape
XP_004967904 296 PVAPLVSLHHLDLIEPISPHGrTALDAVRSLVDAAQLDPARSLQQAFCYHNDSGgsegsnnWSVSVAWGYAAQLYPWAVP 375 foxtail millet
KRH22518     290 PLTPLVSLHHPDHTDPIFPNM-TTTKSLQHLFEAVNVDSERILQQTVCYERRFS-------WTISVSWGYGVQVFQNNML 361 soybean
KRH56089     282 PLTPLLSLHHPDYTDPIFPNM-TTKQALKHLFEAANVDSQRMLQQAICYDRWFS-------WTVSVSWGYAVQVFPNHML 353 soybean
XP_002515719 276 PLSPLVSLHHFDDLDPIFPNM-TTINSLEHLFKAVTVDSQRVLQKTVCYDRWFS-------WTISVAWGYAVEIYGKHIF 347 castor bean
XP_006846343 303 PMSPLLSLHHLDYIAPIFPGM-TRIQALKVLLKASKANPPQLLQQSICYHKEHN-------WSISVSWGYSVQIYQKIYP 374 Amborella trich...
XP_002280577 307 PQSPFLSLHHLDVTDPLFPSM-DRNESVVRLMKAAKVDQSRLLQQTICYHKPYN-------WSFSISWGYSTQIYENIYP 378 wine grape
XP_010317971 297 PQSPFISLHHLDLVSPIFPSM-NHYDALNHLMKAASVDQSRLLQQSVCYNKIHN-------WTFSVSWGYSVQIYDKIIP 368 tomato
XP_015161354 137 PKSLLMSLHHFDMVDPIFPSM-DRVKSVFHLQKVAKYDQSRMLQQTICHHRSKS-------WTFSVSWGYSAHIYEKIMP 208 potato
XP_013665496 117 PTAPLLSLHHFDAVAPLFPGM-NRHGSVLQIMKAANVDQSRMLQQSICYVRASN-------WTFSVSWGYSAHVYEKIFP 188 rape
CBI28968     238 PLAPLVSFHHLDHVDPIFPNM-TANQAIEHLFEAVKVDSERVLQQTVCYDRWFS-------WTISVSWGYAVQVFENHQF 309 wine grape
XP_004967904 376 AHQLEVPLQTFEAL---RGRPDGPFLFNTRPWrPDD-ACAR-PLTFFLSHARNEtygaTaAAATVTEYSRHAggKSMEKE 450 foxtail millet
KRH22518     362 LPDVLRVEKTFKQWk-eGNVLAGIYTFNTREL-HPD-QCKR-PTIFYLDKVSSGk-----DG-IISSY------RKYSQN 425 soybean
KRH56089     354 LPDVLKVQETFKQWr-kGNMLAKSYTFNTREL-HPD-PCKR-STVFFLDNVSSGk-----DG-IISSY------KKSFQN 417 soybean
XP_002515719 348 LPDTLPVQVTFQKWikkGSLLAGAYTFNVKEP-HPD-PCQR-PTIFFLDHVSSSr-----DG-ITTHY------KKSYTN 412 castor bean
XP_006846343 375 PGFLTIPLQTFKPW---RKSGVLSFMFNTRPL-STD-PCEK-PTVFFFDSVKPVs---PfVNLIETVYVGRE--DRSISA 443 Amborella trich...
XP_002280577 379 PSVLERPLQTFVPW---KRIRMPPYMFNTRFP-SRT-PCEA-PHVFFFESAEKIk-----GEQIVTTYIRKF--PRLLPP 445 wine grape
XP_010317971 369 QSYLQTPIETFGEW---RKGAWPPYMFNIRKF-NNYsSCGEvPNILFFDSFEGTk-----LNHFVTTYV-----KKNHRI 434 tomato
XP_015161354 209 RSWIQRPIETFKTWq--PSPNPPYYMFDVRSP-SWD-PCEA-PHVFFFKSVKKTq-----RGEILTTYTRGW--PRGIGA 276 potato
XP_013665496 189 RSYLKLPIETFRPW---LRGWFPFYMSNTRRV-SRN-PCEA-PHWFFFDSIEQV------DGGVVTSYTRKF--IRNMTS 254 rape
CBI28968     310 LPDVLRARKTFRQWk-kGSVLSESYTFNTREL-HID-PCRR-PTIFFMDSVSSGr-----DG-IESSY---R--RDASDG 374 wine grape
XP_004967904 451 CDKP-SLr-SAAAVQTVRVLApKMNPADWER--APRRQCC 486 foxtail millet
KRH22518     426 CSYKe----PMKKLEVIKVFT-NKLYLDNKQlqIPRRHCC 460 soybean
KRH56089     418 CSID--DdvSPKKLEVIKVVT-NKLDLDIKQlrAPRRHCC 454 soybean
XP_002515719 413 CSYDk---aSPRKLEEIKVFS-HKLDLSDKQlwSPRRQCC 448 castor bean
XP_006846343 444 CNLNq---sLPNIVDEVRIFS----ELQDIRvaGSRRQCC 476 Amborella trichopoda
XP_002280577 446 CPSS-GNh-SADYISKVKVFS-PLRRLHGT---GNRRECC 479 wine grape
XP_010317971 435 CANNdDDdhSSNGVMKVHVFS-PMDKLHVGD--GNRKECC 471 tomato
XP_015161354 277 CLSS-GNf-SAEYVSKIHVYS------------STTKRIR 302 potato
XP_013665496 255 CSFS-CDi-SADPLASIRVFSp-----------ITPKEVS 281 rape
CBI28968     375 CTLHm---aSPKRLEEIKVFS-HKLDLKIKQlqAPRRHCC 410 wine grape
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap