5DJ4


Conserved Protein Domain Family
PA26

?
pfam04636: PA26 
PA26 p53-induced protein (sestrin)
PA26 is a p53-inducible protein. Its function is unknown. It has similarity to pfam04636 in its N-terminus.
Statistics
?
PSSM-Id: 398358
Aligned: 33 rows
Threshold Bit Score: 530.683
Threshold Setting Gi: 268565107
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5DJ4_A               43 GPSAFIPVEEVL--REGae---slEQHLGLEALMssGRVDNLAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYIAI 117
KMY96100              4 AVDYYADMGQIS--QDCfaa-tqtGASDFDMDEL--DDLDQVTQVIGYHPQFHDHFLATQNFIMKGDGPLPNDYRYYLAI 78  Drosophi...
WGS:AAQB:GK23074-PA   4 aIDYYAGMGQIA--QDC-------SSTDTDIVDMdpDDLDQVTQVIGYHPRYKDHFLHTQNFIMKGDGPLPYHYRYYLAI 74  Drosophi...
EDO38575            102 GPSSFIPSKELP--SMDtdd--eqTHSLLVDSFLfnGRVPNVTCIIGVHPQYLDWNARTEYFLMRGEGPLPYDWRHYIAI 177 starlet ...
XP_003386260        119 GPSSFMSVKDVAgyHESskpvtheLQQLYENAFLrdARLSNIVQCLSDHPQYLDLFIQTMDFIMNGDGPLNQDVRCYIAI 198 Amphimed...
XP_004348274        294 APSRFIPTPKLM--PMNeepgaeaSYQVMVDSFLhdCRVSHFVRALSYHPTYLAAFLHTHHFILRGDGPLPAHWRNYIAI 371 Capsaspo...
XP_004354715        150 KTTSFINETQLP--PLNsnd--qlTKRLFQEAFLqsGRVNHIIRLLGWHPQYLERFLASYNKVMRDQGPLPLPWRNYIGI 225 Cavender...
Q54WU6              138 RTTVFTSESQLP--PLNtdd--elTRKLFQDVFLqhGRVNHLTRILGWHPQYLEKFLLAYNTIMRDPGPLPLHWRNYIGI 213 Dictyost...
XP_002059309          4 AVDYYAEMGQIS--QDC-------SSTDFDMDDL--DECDQVTQVIGYHPLYRDHFLRTQNFIMKGDGPLPYAYRYYLAI 72  Drosophi...
XP_001688028          4 MVEYYSDMGQIG--QDYgsknsptDSSN----------LDHVTKVIAYHPRYLDHFLNTQKFVMQCDGPLPYDYRNYIAI 71  Anophele...
5DJ4_A              118 MAAARHQCSYLVGSHMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQALLKTgEHTWSLAELIQA 197
KMY96100             79 IAAARHQCPYLVKRYEKEFINQGGDSAWLGGLDFIPAKLRAIYDINKILAHRPWLLRKEHIERLTKG-KNSWSLSEVVHA 157 Drosophi...
WGS:AAQB:GK23074-PA  75 IAAARHQCPYLVKRYEKEFINQGGSSDWLNGLEYIPPKLRAIYDINKILAHRPWLLRKEHIERLTKG-KNSWSLSEVVHA 153 Drosophi...
EDO38575            178 MAASRHQCSYLVSIYEREFLRYHGDKQWLKGIQHIPKKLHALLDMNKYLAHQPWLVSTQLIEKLLKG-EDNWSLSELVHA 256 starlet ...
XP_003386260        199 LASSRHRCSYLVTYLEMEFRAKGGNVLWLKGISHIPTKISNLLILNKMLCHQPWYISQTHFQELLVG-PDSWSVAELVHA 277 Amphimed...
XP_004348274        372 MAAARCGVKYVVSVQQSTFLVNGGDTTWLKGLEFAPVKLQNLDELNMLLAYQPWRVTAEHIRTLLRG-QDSWSLAELVQA 450 Capsaspo...
XP_004354715        226 LASARYNCGYLVALLEHEYLHSGGDPKWLQGVDHIPQKLKNLLKIVEMMAHQPWLLPNVDIEYLVKG-QDAWSIAELVHA 304 Cavender...
Q54WU6              214 LAAARYKCSYIIALQEHEFLMNNGDARWLQGIDHIPAKLKNLLKVIELLAHQPWLLPKLDIEYLVKG-TDAWSIAELVHA 292 Dictyost...
XP_002059309         73 IAAARHQCPYLVKRYEKEFINQGGNSEWLNGLDYIPAKLRAIYDINKILAHRPWLLRKEHIERLTKG-RSSWSLSEVVHA 151 Drosophi...
XP_001688028         72 MAAARHKCTYLVNLYEEIFLANGGDPNWLNGLEHIPPKLRAISDINKILAHRPWLLNKEHVERLTKG-QNSWSLSEVVHA 150 Anophele...
5DJ4_A              198 LVLLTHCHSLSSFVFGCGILPEGDADGSPAPQAPTPPse----------------------------------------- 236
KMY96100            158 MVLLSHFHSLSSFVFSCGLTQKLDGLSSPKLKSPPAAvgalaptilitptspteaqk-----------gkpvlaeislnn 226 Drosophi...
WGS:AAQB:GK23074-PA 154 MVLLSHFHSLSSFVFSCGLTQKLDGLSSPKLKSAPAEiapngngvadgsrqtttspihqqq--------------lqlqq 219 Drosophi...
EDO38575            257 IVIMAHIHALSSFVYGCGVVPEIDSENGHTFKPPTLTe------------------------------------------ 294 starlet ...
XP_003386260        278 VVIMAFFHALAGFCLGCGLNPEIDTELGHTVSDQSEIvpshft------------------------------------- 320 Amphimed...
XP_004348274        451 IVVLTHFHSVSAIAAGAGLTPEVDLEGGHLFATESERae----------------------------------------- 489 Capsaspo...
XP_004354715        305 MILICTFLSLAGFVFSCGILPEYGLASTTTLDERTSFsl----------------------------------------- 343 Cavender...
Q54WU6              293 MVLICTFLSLSGFVFCCGISPECGLSESNNLSSSFsl------------------------------------------- 329 Dictyost...
XP_002059309        152 MVLLSHFHSLSSFVFSCGLTQKLDGLSSPKLKGAPVSmppqspplppvddarqpttspinqqqqqqqqknvlgeislnss 231 Drosophi...
XP_001688028        151 IVLLAHYHSLSSFVFSCGLTQELDGASHKIENNNVLTqktaf-------------------------------------- 192 Anophele...
5DJ4_A              237 -----qsSPP-----SRDPLNNSGgf----------------------esARDV---------------------EALME 263
KMY96100            227 anpdynsQTAas--snGGAPPDSAnaaadgpdatalngylataqqlpqqhGISV---------------------ETLME 283 Drosophi...
WGS:AAQB:GK23074-PA 220 qqqqktvlgeislngssanPIDNSgvgateaaalng--ylataqqqpqqhGICV---------------------EALME 276 Drosophi...
EDO38575            295 -------TNQasfdsGNATTGSESvr----------------------ssTMTR---------------------DELMA 324 starlet ...
XP_003386260        321 -npalgvGGTgsdsePSSEAMSPAcs----------------------ppNEQVskylvehyietskltdtrkldDTIKE 377 Amphimed...
XP_004348274        490 -------------laEQLNSSQDAvgd--------------------atdSSWT---------------------AAMLQ 515 Capsaspo...
XP_004354715        344 -------------neSDCEVEDLTas----------------------enTIKV---------------------MELLK 367 Cavender...
Q54WU6              330 -------------ndSDCEIEDTAat----------------------enTAKV---------------------MELLK 353 Dictyost...
XP_002059309        232 sagggnnTKQdynntMDNNNSRSTgannnfgqhyl----ataelqpqhqcAISV---------------------EALME 286 Drosophi...
XP_001688028        193 ---nrlnDLYnsqhpENLPNGDDAni----------------------rpEVTV---------------------DALMQ 226 Anophele...
5DJ4_A              264 RMQQLQESLLRd-eGtSQEEMESRF------ELEKS--------ESLLVtPSAd----------ILEPSPH--------- 309
KMY96100            284 RMKVLSQKQDE---C-SEAELSSRF------QKVEQ--------QTAEL-AAV-----------TPEAAVGv-------- 325 Drosophi...
WGS:AAQB:GK23074-PA 277 RMKVLSQKQDE---C-SEAELSNRF------KNVEM--------QTAEL-PAV-----------TPEAAVVl-------- 318 Drosophi...
EDO38575            325 RMREVRAEQDTlmeA-SQEELFQHF------EKLESgelahfkdEAAST-PTEsl------------------------- 371 starlet ...
XP_003386260        378 KLAAVSQEEDEteeI-DNDRQFAESvssfglEKIHS--------RSVPT-P----------------------------- 418 Amphimed...
XP_004348274        516 RLNAVAGEAD----V-TEEENVKNF------EKSET--------Efnt--------------ghIHHAASA--------- 553 Capsaspo...
XP_004354715        368 KKKEEQEEDDFedgG-PEIDRQQEFhnagniDADNS--------SSSSS-GSSs---------lATTSSSTyg------- 421 Cavender...
Q54WU6              354 NRRSQQQDDDDdd---qLHDRQQDFhnagddSQSSN--------NNTTT-TTTtttttttttntNTTSNSAgggdsssst 421 Dictyost...
XP_002059309        287 RMKVLSQNQDE---C-SEAELSNRF------KSVEL--------QTAEL-AAA-----------SPEVAVAl-------- 328 Drosophi...
XP_001688028        227 RMKRLSEKNDE---C-SETELSNRF------KHVEQ--------QAAEL-PPV-----------VREAPADv-------- 268 Anophele...
5DJ4_A              310 --------PDMLCFVEDPTFGYEDFTRRGAQ-APPTFRAQDYTWEDHGYSLIQRLYPEGGQLLDEKFQAAYSLTYNTIAM 380
KMY96100            326 -------pTNLSHYVDDANFIYQDFARRGTE-SINTFRIQDYSWEDHGYSLVDGLYNDVGIFLDAKFRAAYNLTYCTMGG 397 Drosophi...
WGS:AAQB:GK23074-PA 319 -------pPIISQYVDDPNFTYQDFARRGAE-NINTFRIQDYSWEDHGYSLVDGLYNEVGTFLDEKFRAAYNLTYFTMGG 390 Drosophi...
EDO38575            372 -------tTDLARYLEDPNFRYQDFASRPQQ-DISTFRIQDCSWEEHGFSLFNRLYPDIGTLLDEKFSSTLGLTYFTLGD 443 starlet ...
XP_003386260        419 --------VNLLRYITDPSYEHEDFTLASAC----TLRAREYSWEDHGFSFLNSLYPLLSELLDEKFKVASEMTYRHVGA 486 Amphimed...
XP_004348274        554 --------SDINRFIRRPDFAHEDFDIKSRE--YSVFRYQDYSWEDHGFSLVDRFYESCAQLLDQQFSIAKTMTYATMGG 623 Capsaspo...
XP_004354715        422 ------giVDMSRYNCNNQLTHTDFDVSSKD--YTIFSVQDYSWKEHGYELVSRIFPDAAPLLDEEFSFVYTMTYYRFNN 493 Cavender...
Q54WU6              422 lsqssdrmSDFSRYIGNNTMTHTDFDVSSKL--YNIFSAQEYSWREHGYELVSRYFPDAAPLLDEEFSFVYTMTYYKFNN 499 Dictyost...
XP_002059309        329 -------pPIISHYVDDASFTYQDFARRGAE-NINTFRIQDYSWEDHGYSLVDGLYNDVGTFLDEKFRAAYNLTYFTMGG 400 Drosophi...
XP_001688028        269 -------pQQLGRYVDDPGFTYQDFARRGAEnIPQTFRIQDYSWDDHGYSLVNRLYNDVGFYLDDKFRAAYNLTYYTIAG 341 Anophele...
5DJ4_A              381 HSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLL 460
KMY96100            398 IKNVDTSKFRRAIWNYIQCIYGIRHDDYDYGEVNQLLVRPLKMFIKTACCFPERITTKDYDSVLVELQDSEKVHVNLMIM 477 Drosophi...
WGS:AAQB:GK23074-PA 391 IKNVDTSKFRRAIWNYIQCIYGIRHDDYDYGEVNQLLVRPLKMFIKTACCFPERITTKDYDSVLVELQDSEKVHVNLMIM 470 Drosophi...
EDO38575            444 RTNVDTTVFRMATWNYIHLIFGIYHDDYLYTEVNKLMERSYKRYIKKVACVPEKATQEDYLEFMPELTHSEKVHINLLLL 523 starlet ...
XP_003386260        487 TKDIDTKPFREATWYYIQSIKGIRHDDYNYGKVNKVLSIEYKTYIRMVACFPEKVSLYDFRECMDGLQFSEKVHVNVLVM 566 Amphimed...
XP_004348274        624 QGGIDTQKLRYAVWYYITRVNGILHDDFNYGTVNELLEREVKLYIKRLACSPAEITQAEYVAASRGLLPSEKIHIAILAT 703 Capsaspo...
XP_004354715        494 STDIDTLPFRRAVWYYVQRVKGMCHDDYNYQEVNMFLSRNLKYYVKKAVCFPDNISKIDYSKLGYDLKPDEKCHLALLAV 573 Cavender...
Q54WU6              500 NTDIDTLPFRRAVWYYVQRVKGMLHDDYNYQEVNMFLSRSLKNFVKKAVCFPETIKRDDYSKLGYSLKPDEKCHLSLLAV 579 Dictyost...
XP_002059309        401 IKNVDTSKFRRAIWNYIQCIFGIRHDDYDYGEVNQLLVRPLKMFIKTACCFPERITTKDYDSVLVELQDSEKVHVNLMIM 480 Drosophi...
XP_001688028        342 RTNVDTSKFRRAIWNYIQCIYGIRHDDYDYGEVNQLLDRSLKMFIKTACCFPERITKLDYDSVLVELQHSEKVHINLMIL 421 Anophele...
5DJ4_A              461 EARMQAALLYALRAITRYM 479
KMY96100            478 EARNQAELLYALREIMRYM 496 Drosophila simulans
WGS:AAQB:GK23074-PA 471 EARNQAELLYALREIMRYM 489 Drosophila willistoni
EDO38575            524 EARLQAELLYATRAIMKYM 542 starlet sea anemone
XP_003386260        567 EARLQAELIYSLKALMSHM 585 Amphimedon queenslandica
XP_004348274        704 EANKQAGLMYALHAVMKYM 722 Capsaspora owczarzaki ATCC 30864
XP_004354715        574 CSHKQAALLYGLYTVMSYQ 592 Cavenderia fasciculata
Q54WU6              580 CSHKQASLLYGLYSVMNYQ 598 Dictyostelium discoideum
XP_002059309        481 EARNQAELLYALREIMRYM 499 Drosophila virilis
XP_001688028        422 EARNQAELLYALREVMRYM 440 Anopheles gambiae str. PEST
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap