Conserved Protein Domain Family
DUF594

?
pfam04578: DUF594 
Protein of unknown function, DUF594
Statistics
?
PSSM-Id: 398331
Aligned: 130 rows
Threshold Bit Score: 59.0817
Threshold Setting Gi: 474015823
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CBI21744     391 RTQACKDLLRLMRGVWVEMLCYAASQCRPNQHAKQLRRGGELLTHVWLLMAHLD 444 wine grape
XP_002863471 725 DSSNEDGKWKVLSKVWVELLCYAASHCKATEHVAQLSRGGELLNFVWLLMAHFG 778 Arabidopsis lyrata subsp. lyrata
Q9FHI9       793 EKTHNKDKWEILSKVWVELLCYAACHCDSTAHVEQLSRGGELINFVWLLMAHFG 846 thale cress
XP_002865243 632 NKMREENMWSVVSKVWMELLFHAACNCDATARMEQLSKGGELLVFVWLALAHLG 685 Arabidopsis lyrata subsp. lyrata
O50072       695 EKNFGEDKWKILSKVWLEFLFHAASHCDATTRMELLSKGGEFINFVWLLMAHFG 748 thale cress
EFH39739     736 SKEDEEVKWEIVSKVWVEMLCYGATYCDPKQHVAQLSNGGEFISFVWLLMAHFG 789 Arabidopsis lyrata subsp. lyrata
Q1PE67       247 NERGNDAMWKVVSKVWVEMLCYAATHCDSKQHAAQLNKGGELINFVWLLMAHFG 300 thale cress
XP_009101588 706 LQKGRENMWEVVSKVWVELLCFAATHCDSQEHASQLSKGGELINFVWLLMAHFG 759 field mustard
CDY52752      16 RGSGGGSIWGVVSRVWVELLYYAANHCESKQHAAHLSKGGEIVSFVWLLMAHMG 69  rape
Q5Z821       735 SMADPGRRWRVVCEVWVEMLGYAAVHCGGYQHAERLKDGGELITFVCLLMTHLG 788 Japanese rice
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap