Conserved Protein Domain Family
DUF563

?
pfam04577: DUF563 
Protein of unknown function (DUF563)
Family of uncharacterized proteins.
Statistics
?
PSSM-Id: 398330
Aligned: 134 rows
Threshold Bit Score: 66.6479
Threshold Setting Gi: 81440548
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAK96561     260 TPFdKWIMQScmSGLATTSHVVPSSDkpthDSVLlanFPDSWSMQHFLDrgmrVVAQSrdHQTRYvatgreghksvEEFW 339 Aspergillus niger
EAX90894      73 REWgHTIDDFi-SGLTYLPESVQKQE----FTIA---IPP--SAGKDLQdw-lQACGF--KVHLFdgy------anQHIF 133 Trichomonas vag...
EAY16507     156 LMWgHNIHDFl-CATMFVPREVLRKG----AYAF---APL--HYYQNTQrl-iDFLHL--NITLIkfe------sgEQYF 216 Trichomonas vag...
XP_001584287   9 HMYgHYIHDFl-SSMMFVPQELMEKG----ILVA---SPK--KSIKAVKdl-vKYLGL--NITFLkmk------kdEQIY 69  Trichomonas vag...
EAY15031      50 NMFgHNIEDYv-AALMFVPKELNDRG----FFVL---TPPCCTNITYQIar---yLGI---NVTFvtir---derrEQIF 112 Trichomonas vag...
XP_001305880  58 PMFgHLIHDFl-ASMMFVPEYVNKSG----FTVI---APR--SGKEIAdi-wcKYLGI--NANIVsla------enEQIQ 118 Trichomonas vag...
XP_001303826 132 EMFgHLIHDFl-CGLMYIPKEVIDQG----VVML---APT--VGKCLGQmw-lDAIGYg-NKIKLlt-------lkQDEQ 192 Trichomonas vag...
XP_001326067 136 YHWgHMVHDFi-NAMMFVPKEIYDRG------FV---VPTLRTGYAATYdf---lYNIg-LADKIklld---lgdgNQVL 198 Trichomonas vag...
EAY14226     136 GQWgHLIHDFf-CAIMHVPQEVYDKG----FYIC---TNP--SGYGMITey-lKYFKMd-KNINVlnid----lktQQVF 199 Trichomonas vag...
EAY09215      82 WHWgHLIHDFf-SAIIHLPKSVIDHG----FITI---TPP--SGRDMTNey-lTAFGY--NTIQLid-------ltPKQQ 141 Trichomonas vag...
CAK96561     340 SY--LGYAANQVLhSDTSFVASQLIwscraplihpWLTQRSLSLLSPESLqpvdksTRK-LILYMTR--SNglnlnaGRE 414 Aspergillus niger
EAX90894     134 VR--QLYVVSHMS-KAHRAFAGGYS----------YMRRKMFERFNLSQ-------INStRFCAMNR--DT------RRY 185 Trichomonas vag...
EAY16507     217 VR--KLYVVANHA-FAHGYTVYGIY----------KMRELVFERFNNTK-------DKAtRFVVFNRpkGE------SRR 270 Trichomonas vag...
XP_001584287  70 VK--KLWIVHTLE-LGHGYASGGFT----------RMRKLIMEKVDFNK-------IKPtRFVLADRppKS------GRN 123 Trichomonas vag...
EAY15031     113 AK--KLWIITSRE-LGHGYASGGFH----------RMRAIIFQKEEYKKI------KPE-RYVVVNRppRS------RRF 166 Trichomonas vag...
XP_001305880 119 AA--KLFLISGRK-AAHSVTVGGIK----------RLRKYIEERLNLSN-------IIPtKYVLGNRpkSA------YRS 172 Trichomonas vag...
XP_001303826 193 VLvhKLYYVSTLI-FGHGCTIGGFR----------RLRNLIFDKYKLDQ-------IKPtKFQIINRi-GK------ERL 247 Trichomonas vag...
XP_001326067 199 VD--ELYILGTTH-YAHGYSVGGFQ----------RLRKLVFNRFQLNG-------IKPyKFCIINRp-GK------TRL 251 Trichomonas vag...
EAY14226     200 VN--KLYILSSLH-FAHGYTVGGII----------KLRKLIFKIFKLEG-------IKPyKYSIINRp-GL------SRK 252 Trichomonas vag...
EAY09215     142 VHvdSLIVLSSLY-QSHGYSIGGIK----------RLRKLVFDRYDLHN-------IKPyKYSLINRp-GK------KRI 196 Trichomonas vag...
CAK96561     415 VLNEDIL---LadiQALLD-KRGkreqlkiFN-----HE-DFP-STDALMrYVHqNVKAVIGPHGSALHNHFWT-AEDTL 482 Aspergillus niger
EAX90894     186 LGNFNEV---VdglNKYVKiDDGk-----tWEvihnqHN-----IYEQVK-LWP-TIKVLFTVGGSQLFNCMFM-HNSTG 249 Trichomonas vag...
EAY16507     271 IHNEEELlaaLkanTTIDP-GKE-------WEli--dKP-YGD-WDYTCK-LWM-TFKVIVSPSGSMLYNSIFM-PNKTG 335 Trichomonas vag...
XP_001584287 124 FENPKLM---L----KYLN-DYTvidkgckWVrdd--kffGVP-VEQIVK-YWQ-SIKVLVTLQGSGIYNAIFM-HEKCG 189 Trichomonas vag...
EAY15031     167 FDDANKL---VkilNENTTlEKG-------CQwvrddKSyGIP-FSDMIK-YWM-SLKVLVTVQGSGIYNGIFMhEN-TG 232 Trichomonas vag...
XP_001305880 173 ILHIDKL---Y----ESLK-KIN-------ENfv--lHEnEFDnLEENAK-FWS-DIRIYVGPCGSNIYNSVFM-RENTG 232 Trichomonas vag...
XP_001303826 248 IHNVDELlgnLtlyCKIDE-GEK-------WIyt--yPN-STD-IKDVAK-LWS-GTKLLIAPAGSGIYNSVFM-APRTG 312 Trichomonas vag...
XP_001326067 252 IHNIKEL---LqalTEKTKiDEGq-----kWii---eDSnVSD-FNATVK-RWS-TIKMVVTPSGSGIYNSIFMqEK-TG 316 Trichomonas vag...
EAY14226     253 IHNIKEL---LaalSQECP-PKSe-----kWQie--qWD-FND-IGKTVK-IWS-TIKVVCHPSGSGYYNSIFM-QENTG 316 Trichomonas vag...
EAY09215     197 IANVQEL---LdslNKNVP-VDGk------WNee--kMN-IHD-FNSTVK-IWS-VAKVVVTPCGSSCYNSIAM-QEMTG 259 Trichomonas vag...
CAK96561     483 LIEFmPTSRPDFAFYEAARMRDQPYAVLMLDP 514 Aspergillus niger
EAX90894     250 LIVL-FPNNVLTEQMSIAFQNHMFSAVIYHKD 280 Trichomonas vaginalis G3
EAY16507     336 MCVM-FTRQLDRPNLQLAIGSNIYLIGVTHLN 366 Trichomonas vaginalis G3
XP_001584287 190 MCLV-FSSINDGPNLHLCTHLHIFLIGVIHPR 220 Trichomonas vaginalis G3
EAY15031     233 MCLL-FCDIVDTPNLQLCTHLHIFTIGVIHPG 263 Trichomonas vaginalis G3
XP_001305880 233 LCLL-FS-HMDLPNVHLCITSNFYMIGLVQQC 262 Trichomonas vaginalis G3
XP_001303826 313 MVIM-MTHRIDMPNFHLALAGEFYMIGVGHKK 343 Trichomonas vaginalis G3
XP_001326067 317 ILVM-MTFMMDMPNIHVAAISNIYMIGVGHKK 347 Trichomonas vaginalis G3
EAY14226     317 YLAM-MSKQKDFPNFHLAAISNMYIVGITHTN 347 Trichomonas vaginalis G3
EAY09215     260 LLIM-MSHILDVPNFVLAAASNICLVGVANPQ 290 Trichomonas vaginalis G3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap