Conserved Protein Domain Family
zf-FLZ

?
pfam04570: zf-FLZ 
zinc-finger of the FCS-type, C2-C2
zf-FLZ is a FCS-like zinc-finger domain found in higher plants. It is bryophitic in origin. It carries a zf-FCS-like C2-C2 zinc finger, consisting of a consensus cysteine-signature sequence with conserved phenyl alanine and serine residue associated with a third cysteine. It acts as a protein-protein interaction module.
Statistics
?
PSSM-Id: 398324
Aligned: 59 rows
Threshold Bit Score: 64.9661
Threshold Setting Gi: 125554768
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WGS:AAAA:OsI_22391  14 SCAGGGDGDYHYLDACFLCKRDITSTAtSSCVSTGNAAFCSDDCRQDQMDMDS 66  long-grained rice
EFH52973            34 EKDKAQVQVNNFLELCRFCKKNLRHDE-DVFMYGYFGAFCSKQCRAKQMALDI 85  Arabidopsis lyrata subsp. lyrata
EMS66659            39 dDADQLLGHHHYLDICFSCRKLLAGNK-DIFMYRGDTPFCSEECRQEQIEIDE 90  Triticum urartu
WGS:AAAA:OsI_21442  29 AGGGGGDGDYHYLDACFLCKRDITFNR-HIFMYKGNAAFCSDDCRQDQMDMDS 80  long-grained rice
OQU85611            48 NADAAGELHHHYLDACFRCGRHLGGNK-DIFMYRGDTPFCSDECRQHQIEADE 99  sorghum
XP_002449333        50 NDATAGERGHHFLDACGRCGRLLGRNK-DIFMYRGDTPFCSEECRQQEMDADE 101 sorghum
EMS65147            43 SRDDAGELGHHYLDACFRCGRTIAGNK-DIFMYRGDTPFCSEECRQQQIDTDE 94  Triticum urartu
XP_009400220        62 DEVDGECEPRHFLDSCSLCRKPLSRNR-DIFMYRGDTPFCSEECRQERIEIDE 113 wild Malaysian banana
ACU14475            27 aGSEDHYEEPHFLQACFLCRKPLGQNR-DIFMYRGNTPFCSKECRQEQIEIDE 78  soybean
ERN15488            60 ESRSFYDGGAHFLQACHLCNKPLGNGR-DIFMYRGDTPFCSEECREEQMAKDE 111 Amborella trichopoda
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap