3IYD,4C2M,3H0G,6RFL


Conserved Protein Domain Family
RNA_pol_Rpb2_3

?
pfam04565: RNA_pol_Rpb2_3 
RNA polymerase Rpb2, domain 3
RNA polymerases catalyze the DNA dependent polymerization of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial. and chloroplast polymerases). Domain 3, s also known as the fork domain and is proximal to catalytic site.
Statistics
?
PSSM-Id: 398321
Aligned: 103 rows
Threshold Bit Score: 70.2462
Threshold Setting Gi: 1710670
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3IYD_C                    513 QFMDQNNPLSEITHKRRISalgPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLSVYAQ 580 
EGT55139                  353 VIAERINQLRFVSHFRAIH---RGAFFMEMRTTDVRKLRPEAWGFICPVHTPDGAPCGLLNHVTASCR 417  Caenorhabditi...
KRY27727                  429 IIAERLNHLRFVGHFRGIH---RGAFFSEVRSTDVRKLSTEAWGFICPVHTPDGSPCGLLNHLAASCR 493  Trichinella s...
XP_004032431              387 IIADKLNNMRFLSHFRSVH---RGAYFTEMKTTTVRKLLPENWGFICPVHTPDGAPCGLLNHIAMTCK 451  Ichthyophthir...
EDV29396                  136 LVADRLNFMRFVSHFRSVH---RGSFFTEMRTTAVRKLLPEAWGFLCPVHTPDGAPCGLLNHLAASCK 200  Trichoplax ad...
WGS:AAFB:cds.EHI_186020A  435 ITAERLNHSRFTSHFVSVH---RGAFYTTMKTTSIRKLVPEAWGFMCPVHTPDGAPCGLLNHFAVSCR 499  Entamoeba his...
EIJ88273                  470 IVAERLNYMRFFSHLRSVH---RGSFFEAMRTSTVRKLLPESWGFLCPVHTPDGSPCGLLTHLSHACV 534  Nematocida pa...
CBN75850                  408 IVAERINFLRYLAHFRSVH---RGQFFTTMKTTAVRKLLPESWGFLCPVHTPDGSPCGLLNHLATACK 472  Ectocarpus si...
EGD78089                  448 IVADKLNILRYMSHFRCVH---RGAYFAEMKTTAVRKLLPEAWGFICPVHTPDGAPCGLLNHLTRHCT 512  Salpingoeca r...
XP_018229687              459 IIAEKLNFYRYLSHFRTVH---RGAFFADVKSVTVRKLLPEAWGFICPVHTPDGAPCGLLNHLTSKCK 523  Pneumocystis ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap