5UI8,5UI5


Conserved Protein Domain Family
Sigma54_DBD

?
pfam04552: Sigma54_DBD 
Sigma-54, DNA binding domain
This DNA binding domain is based on peptide fragmentation data. This domain is proximal to DNA in the promoter/holoenzyme complex. Furthermore this region contains a putative helix-turn-helix motif. At the C-terminus, there is a highly conserved region known as the RpoN box and is the signature of the sigma-54 proteins.
Statistics
?
PSSM-Id: 398310
Aligned: 25 rows
Threshold Bit Score: 192.458
Threshold Setting Gi: 81342873
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5UI8_M       317 QFIRSNLQEARWLIKSLESRNDTLLRVSRCIVEQQQAFFEQGEEYMKPMVLADIAQAVEMHESTISRVTTQKYLHSPRGI 396
P24219       275 SYLSAKYQEWRWLSRALRQRKQTITRIINELITRQKDFFLKGRSAMKPLTLREVADCLSLHESTVSRAIKGKTIQTPYGL 354 Bacillus subtil...
Q837Q1       275 EYIKDKKNEFEWLERAVNQRGDTILRVGQEIVRRQEAFFLEADRPLKPMTLKEIADALSIHESTVSRAVNGKYLETTFGV 354 Enterococcus fa...
O66858       245 KELKEAFERYESIRKVLDIRRRNLRKVLEKIVERQKDFLT-GKGSLKPLTLREVSSEIGIHESTLSRIVNSKYVKTPVGT 323 Aquifex aeolicus
D5ANH9       264 AERRKALAEARALAQALERRGDTLLRTAAVLVARQSAFLDKGPAHLVPLTLEDVASELGLHASTISRAVSGRMIQTQTRA 343 Rhodobacter cap...
Q3J0I5       270 aWLARARSQARWLERAVERRQATLLRTAVCLVRHQADFLDQGPRALRPLSMEEVALELDLHPSTISRATATRLIETPRGL 349 Rhodobacter sph...
WP_013108973 336 EYIKRKVESAKWLIESIEQRHNTLKRVAQAIVDHQIEFLEKGPEFISPLKMQQIADIVKVHVTTVSRAVDDKWIQTPRGL 415 Planctopirus li...
O51406       264 SENPQKQKKAKWLIESLRYRDEILAKIGIAIYTLQKEFLRRGFKSLRPMNLSILSEKISVSKSTISRAIKNKYLKCEWGT 343 Lyme disease sp...
Q1DDF1       345 DFIQDKLRSAMWLIRSIHQRQRTIYKVTESIVKFQRDFLDKGIAYLKPLILRDVAEDIGMHESTVSRVTTSKYVHTPQGI 424 Myxococcus xant...
Q9K710       283 QYAKEKYHQMQWLVKSIQQRQQTLLKVTEAILRKQRAFFEEKEGALQPLTLREVAEEIGVHESTVSRATTNKYAQTPRGL 362 Bacillus halodu...
5UI8_M       397 FELKYFFSSHV-NTEGGGE-ASSTAIRALVKKLIAAENPAKPLSDSKLTSMLSEQG-IMVARRTVAKYRESLSIPPSNQR 473
P24219       355 FEMKLFFSAKA-EASGDGD-ASNYAVKTHLENLINQEDKTKPLSDQKLVDLLYEQHgIQISRRTVAKYRDQMNIPSSAAR 432 Bacillus subtil...
Q837Q1       355 FELRSFFSTSIlSSEEDGEdVSTTMVKKQLQKLIDQEVKSKPLSDQKLVERLKDSG-MEISRRTVAKYREALGIPSSSKR 433 Enterococcus fa...
O66858       324 YSLRTFFVRES-AEGLTQG----ELMK-LIKEIVENEDKRKPYSDQEIANILKEKG-FKVARRTVAKYREMLGIPSSRER 396 Aquifex aeolicus
D5ANH9       344 LPLRAFFSRAV-STQGGGEaVSRDSALDFVQRTVGGEDPQNPLSDDAIVTLAERAG-LRIARRTVAKYRSTLGLASSYER 421 Rhodobacter cap...
Q3J0I5       350 IPLRAFFSRSV-SSDGPEApQSQDALMALVREIIAREDRTKPFSDDAIVKQAKLAG-AVLARRTVTKYRETLGIPSSYDR 427 Rhodobacter sph...
WP_013108973 416 FPLKRFFGGGT-TTAEGEE-VAWHIIRLKLKEIVDGENKDDPLSDDALVEELAKHG-FNLARRTVTKYRKALNIPSSRQR 492 Planctopirus li...
O51406       344 ILIKELFSS-V-GGAKTNE-FSKLSIKITVKKLLEA-NKKM--SDKEISVILKSKG-ISISRRTVNKYRNELK---SEKG 413 Lyme disease sp...
Q1DDF1       425 FELKYFFNSSI-ARVSGED-TASEAVKHHIKQLVAQEDARNPYSDQKIVELLRSQG-TEIARRTVAKYREVLGILPSSKR 501 Myxococcus xant...
Q9K710       363 LELKSFFVSSI-SSRFGEKgPSSDSVKKLVRKLVEEENKAKPLSDQKIAHLLKDQYnVEASRRVIAKYRDELGIPSSTKR 441 Bacillus halodu...
5UI8_M       474 KQ 475
P24219       433 KR 434 Bacillus subtilis subsp. subtilis str. 168
Q837Q1       434 KR 435 Enterococcus faecalis
O66858       397 RI 398 Aquifex aeolicus
D5ANH9       422 RR 423 Rhodobacter capsulatus SB 1003
Q3J0I5       428 KR 429 Rhodobacter sphaeroides 2.4.1
WP_013108973 493 Rs 494 Planctopirus limnophila
O51406       414 RT 415 Lyme disease spirochete
Q1DDF1       502 KR 503 Myxococcus xanthus DK 1622
Q9K710       442 KR 443 Bacillus halodurans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap