5IPM


Conserved Protein Domain Family
Sigma70_r3

?
pfam04539: Sigma70_r3 
Click on image for an interactive view with Cn3D
Sigma-70 region 3
Region 3 forms a discrete compact three helical domain within the sigma-factor. Region is not normally involved in the recognition of promoter DNA, but as some specific bacterial promoters containing an extended -10 promoter element, residues within region 3 play an important role. Region 3 primarily is involved in binding the core RNA polymerase in the holoenzyme.
Statistics
?
PSSM-Id: 398301
Aligned: 71 rows
Threshold Bit Score: 34.5044
Threshold Setting Gi: 81794156
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5IPM_F       174 ELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNERITSVDTPLGGDSEKALLDILADEKENGPEDT 249 Escherichia coli
Q9KQD4        99 HNREISQAIAVLEGELNRDPTDAEVAKFLNMSLEQYHSVLMDINCSRIVGIEDLGVSDDAISPFEEGE-DNSPFHG 173 Vibrio cholerae
Q88EW1       100 NTRMVSDAMRAVEARTGRDAKDHEVAAELQLSLDDYYGILNDTLGSRLFSFDDLLQ-DGEHEGLHEDG-ASGQVep 173 Pseudomonas putida ...
P0AEM6        96 NAREVAQAIGQLEQELGRNATETEVAERLGIDIADYRQMLLDTNNSQLFSYDEWREEHGDSIELVTDDHQRENPLQ 171 Escherichia coli K-12
CAR43378      96 NAREVTQSIHQLEQDLGRPPSEQEVADHLQIELAEYRQILLDTNNSQLFSYDEWHEIYGESCEPSQDEDHDDNPlq 171 Proteus mirabilis H...
Q8P9F9       104 rARDAAAAVRKIEQNTGRAAAATEVAAAMEMPLPDYLRLMEDAARGQVLSLESRIEDHGELDT-TAKG-GPNPQQM 177 Xanthomonas campest...
Q9ZSL6       263 LTAKVAEASNVLTRKLRRQPSCEEIAEHLNLNVSAVRLAVERSRSPVSLDRVASQNGRMTLQEIVRGPDETRPEEM 338 thale cress
O22056       416 ATYRVKEARKQLYSETGKHPKNEEIAEATGLSMKRLMAVLLSPKPPRSLDQKIGMNQNLKPSEVIADPEAVTSEDI 491 thale cress
XP_002468115 371 ASSRVKECCRRLRRELKRLPSNEEIAVDTGMTIRRVEAAMSLPKYSVSFTSKVGCT-DVTYQEIMPDTSAETAEEV 445 sorghum
AQK49745     382 ASYRVKECTKRLRRKLRRRPTNEEIAVDTGIPIKRVEAAVNLPKYSVSLDSKIGST-DMTYQEVTADPSAETAEEM 456 Zea mays
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap