Conserved Protein Domain Family
Herpes_UL56

?
pfam04534: Herpes_UL56 
Herpesvirus UL56 protein
In herpes simplex virus type 2, UL56 is thought to be a tail-anchored type II membrane protein involved in vesicular trafficking. The C terminal hydrophobic region is required for association with the cytoplasmic membrane, and the N terminal proline-rich region is important for the translocation of UL56 to the Golgi apparatus and cytoplasmic vesicles.
Statistics
?
PSSM-Id: 398298
Aligned: 2 rows
Threshold Bit Score: 258.492
Threshold Setting Gi: 1767131701
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P28282   1 MALGAGHAHACRDDGDDSVIDAPPPYESVAGASAGQFVVIDIDTPTDSPPPYSAGTSPVGLVSPASSGDGEVCERGRSRR 80  Human herpesvirus 2 s...
P10240   1 MASEAAQPDAGLWSAGNAFADPPPPYDSLSGRNEGPFVVIDLDTPTDPPPPYSAGPLLSVPIPPTSSGEGEASERGRSRQ 80  Human alphaherpesviru...
P28282  81 AAWRAARRARRRAERRARRRSFGPGGLFVeTPLFLPETMIGAHPGVGGDLPSGLPTYAEATSDRPPTYAMVMAACPTEPP 160 Human herpesvirus 2 s...
P10240  81 AAQRAARRARRRAERRAQRRSFGPGGLLA-TPLFLPETRLVAPPDITRDLLSGLPTYAEAMSDHPPTYATVVAVRSTEQP 159 Human alphaherpesviru...
P28282 161 GGSVGPADQPRVQSSRTWRPPLVNSRELYRAQRAARC 197 Human herpesvirus 2 strain HG52
P10240 160 SGALAPDDQRRTQNSGAWRPPRVNSRELYRAQRAARG 196 Human alphaherpesvirus 1 strain 17
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap