Conserved Protein Domain Family
Herpes_U59

?
pfam04529: Herpes_U59 
Herpesvirus U59 protein
The proteins in this family have no known function. Cytomegalovirus UL88 is also a member of this family.
Statistics
?
PSSM-Id: 398296
Aligned: 8 rows
Threshold Bit Score: 418.368
Threshold Setting Gi: 81964677
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
YP_081536  18 PTPGWHDAALLMDDGTVREHAFRNGPLSQLIRRVLPPPPDAEDD----VVFASELCFYCSGRFNRRSSVFSIYWQKHSDL 93  Human cytomegalovirus
Q8QS11     35 LAPGWRDAALVQGDGSVREHAFKNVALSELVRRVIPPPPDADEG----VVFASELSLYSSGRVSRISSVFSIYWQGHSEL 110 Chimpanzee cytomeg...
Q2FAI9     19 PGPGWRDAALIMHNGMVREHMFYHPDVAEIVRRMIPPPPDAEEG----CVFASELAFYTSGRCNRASSVFSIYWQNNSEI 94  Rhesus cytomegalov...
P52364      6 IFPVWKDCTLYVNNETATVHEILNSDLSELLQLKTE------------FVSMTDLCVYITGCINQNISSITIYWHAYSEV 73  Human herpesvirus ...
Q9QJ24      5 MADEWFDCAIRLDSETIAVHEIFNSDLSKLLNLHSK------------TVYMSDLCAFISGCVNRNVGKLTIYWHVYGDI 72  Human herpesvirus ...
CAP08128   23 PGAIWCDGAVLMSDGTIMEHEFYSKPLVSLIRRKIRVEREEDDErgtaFVSSRELSLFVTGRCRRRAAGFSIYWHSHSDL 102 Murine cytomegalov...
Q9DWB4     15 PEAVWCDGALVLGDGTVLEHHVYSASLAALVRRKIRAERADDERe--dYVGSREISLYVTGRYRRRTSGLSVYWHAHSDV 92  Rat cytomegaloviru...
Q91TK9      6 PEGEWQDAALRLTDGSVLEHRLRNAGSADLVRPTLRRPGDADAD----TVFLSELAVYVHGLCGRRAHGFSIYWATHGEL 81  Tupaiid betaherpes...
YP_081536  94 VYALTGITHCAKLVVECGQLgssrlrwrdg-------------------------------------------------- 123 Human cytomegalovirus
Q8QS11    111 VYILTGLTHCTKLVVECGQMkgtvtgdrgwdgdsrhrhsissphhsgssssshshrsrhtgysnsrprhshssgsststt 190 Chimpanzee cytomeg...
Q2FAI9     95 VYAMTGITHCIKIVVECGQV------------------------------------------------------------ 114 Rhesus cytomegalov...
P52364     74 IYALTGIIHCEKISIECGIK------------------------------------------------------------ 93  Human herpesvirus ...
Q9QJ24     73 IYALTGILHCVKITIECGER------------------------------------------------------------ 92  Human herpesvirus ...
CAP08128  103 IFVLTGVTYCAQIYVECGRM------------------------------------------------------------ 122 Murine cytomegalov...
Q9DWB4     93 IYILTGVTYCAQIYIEYGAEl----------------------------------------------------------- 113 Rat cytomegaloviru...
Q91TK9     82 VYVLTGLTHCVRLYVESGRA------------------------------------------------------------ 101 Tupaiid betaherpes...
YP_081536 124 ----dasgeerrgDDDSR-------------DELYDVPGIYMIRVNDgGSTGPRHVIWPGTSVLWAPDVVITTVQ--RRI 184 Human cytomegalovirus
Q8QS11    191 tsssrdtssgglgDRDDRgrgagsgamavedDLLYEVPGIYMIRVSD-GNMGPRNVVWPKTSVLWAPDVEISTVR--RHS 267 Chimpanzee cytomeg...
Q2FAI9    115 -------------GSDSVe------------RQFYDSPGIYLIRVSD-GTVVPRNVVWPGTSVRWSKEVGIRVVQ--RRV 166 Rhesus cytomegalov...
P52364     94 -------------STDNN--------------ILYEKPKLFLLR----ENLAPTELRW-------KSLIKTKTIK----S 131 Human herpesvirus ...
Q9QJ24     93 -------------IADGR-------------YRLYEIPKLFLMR----GQSTPLELKW-------KHAVGIATTN---KP 132 Human herpesvirus ...
CAP08128  123 -------------APDGT-------------MEMLIEPRVLLVRARD-PNGGISHVSWSKTPGIWPKDVGIKLVKisSNA 175 Murine cytomegalov...
Q9DWB4    114 ------------pGRDGY--------------EVFLEPRVVLVRARD-ANNGISKVSWSQTPGVWPRDVDIKLVRvpPDA 166 Rat cytomegaloviru...
Q91TK9    102 -------------SESGP--------------LFFDVPKVYVFESLD---GDPAELTW-------APEVRFEPIS--RRR 142 Tupaiid betaherpes...
YP_081536 185 SAARALVNTFrqyffllerrsheelvlcpPEMEERLAPLLQSATR----------------------------------- 229 Human cytomegalovirus
Q8QS11    268 AAVRAFASALrnymfwmgrrsqeelevcpPEVEDHLAPLLRGPTR----------------------------------- 312 Chimpanzee cytomeg...
Q2FAI9    167 TVARAFVSLFrnylfwtkqpfsedlcpcpPDVEDRLFPLLN-LSR----------------------------------- 210 Rhesus cytomegalov...
P52364    132 ALSPNQNEIF-------------------PKIAHKPSILLEIEEA----------------------------------- 157 Human herpesvirus ...
Q9QJ24    133 LLTHVLTDVLetsp------------ftlPDT------LLSVQEL----------------------------------- 159 Human herpesvirus ...
CAP08128  176 PAARQPTPVM-------------------PNVGMIGFPCVRLFGEptnidigayvplvv--------------------g 216 Murine cytomegalov...
Q9DWB4    167 PGARPPVIVC-------------------PDVGAVGFPRLPLAGDvlfnsnnnsnkdpaggasaagrelwapvvvgdrev 227 Rat cytomegaloviru...
Q91TK9    143 PTARHLEWSL-------------------------AAPLSRGDAGaagrgrtvsp------------------------- 172 Tupaiid betaherpes...
YP_081536 230 -------------GDSDMFDGVVASAYHRL-----RMSNIPRSSARLLEHCVGLAGAKKLLLLDVPR-LENYFLCQVCLY 290 Human cytomegalovirus
Q8QS11    313 -------------GDSEIFDGLVGSAYQRL-----RQSDIPRSSSLLLEHCVGMASLKKLLLLDLPR-LENFYLCQVCLY 373 Chimpanzee cytomeg...
Q2FAI9    211 -------------GDIEVFDKKVCCAYKRL-----QKNDLPRAGRRLLDHCVTLAASKKILLLDLPR-LENFFLAQVCLY 271 Rhesus cytomegalov...
P52364    158 ----------------PRFKEMVSCIWKLVa---eEATITSKSENDIVKTCKKLAESQRYTLTNGTV-LQNFILVHACLF 217 Human herpesvirus ...
Q9QJ24    160 ----------------SIFRERLSYIYYVLg---lDVDIVARTEREIFQKCAELARLQQVFLIQGNI-MENFVLVQACLF 219 Human herpesvirus ...
CAP08128  217 dreqytderlrldCETSIFLERASAVYLRLlaierELETSLGRRREVLMRCVELAARKRLLLVDGTP-IGNMFASEVCLC 295 Murine cytomegalov...
Q9DWB4    228 lsafcsdsrprldCDTTLFLERAASVHRRLlvidrELEGSVGRRREVLQNCLRLASAKRLLLVDGPA-VVGLFAAHVCLY 306 Rat cytomegaloviru...
Q91TK9    173 ---ldddesgwlgWALPSFGEKVALAYAGLs---aAVDASSGTAGVLLARCRELAARRCLRWSRGTTdLEDFFLARICLY 246 Tupaiid betaherpes...
YP_081536 291 ELDEDE----MGEEMLGMLAGKPEDaavsgASGGFLLHRKTMKLAACLCLLLNSLHLHQEALEALDPpp-----pRVEEN 361 Human cytomegalovirus
Q8QS11    374 ELDEDE----VGEEMLGMLAGRPGDs---gDAAEFFLHRKTMKVAACLALMLNCLHKYQEGLSTIEQlqsvlqqqRLDEN 446 Chimpanzee cytomeg...
Q2FAI9    272 ELDEDE----VGEELLGMLCGKSTE-----SDSTFLLHRKTMKVAACVAFILNCFYKHQERLPEVNN--------RVDEC 334 Rhesus cytomegalov...
P52364    218 KLGAVN----FWEEMNGKLRQRPEL-----MSKSFTGHEECFYNCYYLCTLLNSIYSYKTLLPEI-----------VDNT 277 Human herpesvirus ...
Q9QJ24    220 QLGADG----LWEEMSGSVRPRPEL-----MSSAFIQHRVMVNNCYCLAVIFNAIYKHKVSLPTVER-----------SH 279 Human herpesvirus ...
CAP08128  296 GLGEDS----YANEIVGVLWRRRDTk----SGAVFNLHNVALANGTQLALILRRIQEYSAYLPPVER--------RLDMT 359 Murine cytomegalov...
Q9DWB4    307 GLGEEN----IAADLVGVVYRRRDH-----AEPSFRLHNTALANAMQLALALRRLREHQDRLPAVER--------RLDPG 369 Rat cytomegaloviru...
Q91TK9    247 GLGQEDeaehLAEDLLGLLACRPSDgggdgGGAAFDRHHRVYRKAAAVANVLTGLYERQDELPASDE--------RLERH 318 Tupaiid betaherpes...
YP_081536 362 DLVNVVLRRYYRSHGGVQARTLAAARALLADYAETFSPLGSFTRLgyDRLVSADAGVSRRHLVALLRA 429 Human cytomegalovirus
Q8QS11    447 DLILVALRRYYRHRTGVHARTLAAAKALISEFAENFSPMGSYTRLgfDRLGALDAEVSIQDLVAVLRA 514 Chimpanzee cytomegalovirus
Q2FAI9    335 DLAVIALRRYYRHHAGIQTRAIAMAQKFLTDYSESFSPFKSFSRM--EVQVPLDAAVTRKQLVAVLRS 400 Rhesus cytomegalovirus
P52364    278 RSIHVVVKAYYSEHIDVSYKILSYSTNMMNLFSQYLNFTDLLPYI--NKHIKIDVSASKQDMIKFLNA 343 Human herpesvirus 7 strain JI
Q9QJ24    280 EIVHRVVQEYYKSYVNAPLSVLVCATKVLTLFTEEYNFQSALVFV--SQFFQVDVEASRADVIRLFLA 345 Human herpesvirus 6 strain Z29
CAP08128  360 DPLTSAARDFYAAEVDVGVSVVSVAADVLRAFSLRGLVSDGVKVVe-KLGVPMTGPVDRDDVIRVLQL 426 Murine cytomegalovirus (strain...
Q9DWB4    370 DPMVCAAQDFYTGEIDVKLSVISMAAEVLRAFSARGMVDDAAALL--QGRVPLLGSVDRGDLVRVLRL 435 Rat cytomegalovirus Maastricht
Q91TK9    319 DPAARAAARYYERFLGVRQTTLYHGREFLRRFLASLSVAQSLPPLrlPFDAAAVGRASRADVGCVLRL 386 Tupaiid betaherpesvirus 1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap